New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human NAT9 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NAT9 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-207 of Human NAT9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NAT9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NAT9 GST (N-Term) Protein

  • DKFZP564C103
  • EBS
  • EBSP, hNATL
  • EC 2.3.1.-
  • embryo brain specific protein
  • Embryo brain-specific protein
  • N-acetyltransferase 9 (GCN5-related, putative)
  • N-acetyltransferase 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NB110-56916
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
NB300-536
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-16366
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-70694
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-89142
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB

Publications for NAT9 Recombinant Protein (H00026151-P01) (0)

There are no publications for NAT9 Recombinant Protein (H00026151-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT9 Recombinant Protein (H00026151-P01) (0)

There are no reviews for NAT9 Recombinant Protein (H00026151-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAT9 Recombinant Protein (H00026151-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAT9 Products

Bioinformatics Tool for NAT9 Recombinant Protein (H00026151-P01)

Discover related pathways, diseases and genes to NAT9 Recombinant Protein (H00026151-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT9 Recombinant Protein (H00026151-P01)

Discover more about diseases related to NAT9 Recombinant Protein (H00026151-P01).
 

Pathways for NAT9 Recombinant Protein (H00026151-P01)

View related products by pathway.

Research Areas for NAT9 Recombinant Protein (H00026151-P01)

Find related products by research area.

Blogs on NAT9

There are no specific blogs for NAT9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NAT9 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT9