NAP1L2 Antibody

Images

 
Western Blot: NAP1L2 Antibody [NBP1-57024] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAP1L2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NAP1L2 (nucleosome assembly protein 1-like 2) The peptide sequence was selected from the middle region of NAP1L2. Peptide sequence VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAP1L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NAP1L2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NAP1L2 Antibody

  • BPXMGC26243
  • brain specific gene BPX
  • Brain-specific protein, X-linked
  • nucleosome assembly protein 1-like 2

Background

This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown; however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2807
Species: Hu
Applications: IHC, WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
H00004675-D01P
Species: Hu
Applications: ICC/IF, WB
NBP2-24727
Species: Ca, Hu, Mu
Applications: ICC/IF, WB
NBP2-37252
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-36543
Species: Hu
Applications: IP, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-19491
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP3-15005
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-68133
Species: Hu
Applications: IHC, IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-57024
Species: Hu, Mu
Applications: WB

Publications for NAP1L2 Antibody (NBP1-57024) (0)

There are no publications for NAP1L2 Antibody (NBP1-57024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAP1L2 Antibody (NBP1-57024) (0)

There are no reviews for NAP1L2 Antibody (NBP1-57024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAP1L2 Antibody (NBP1-57024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAP1L2 Products

Bioinformatics Tool for NAP1L2 Antibody (NBP1-57024)

Discover related pathways, diseases and genes to NAP1L2 Antibody (NBP1-57024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAP1L2 Antibody (NBP1-57024)

Discover more about diseases related to NAP1L2 Antibody (NBP1-57024).
 

Pathways for NAP1L2 Antibody (NBP1-57024)

View related products by pathway.

PTMs for NAP1L2 Antibody (NBP1-57024)

Learn more about PTMs related to NAP1L2 Antibody (NBP1-57024).
 

Research Areas for NAP1L2 Antibody (NBP1-57024)

Find related products by research area.

Blogs on NAP1L2

There are no specific blogs for NAP1L2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAP1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAP1L2
Uniprot