myozenin 3 Antibody

Images

 
Western Blot: myozenin 3 Antibody [NBP1-90616] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: myozenin 3 Antibody [NBP1-90616] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: myozenin 3 Antibody [NBP1-90616] - Staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

myozenin 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOZ3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
myozenin 3 Protein (NBP1-90616PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for myozenin 3 Antibody

  • FATZ related protein 3
  • myozenin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15128
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
AF5346
Species: Hu
Applications: WB
AF5480
Species: Hu
Applications: IHC
NBP1-85439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
AF8519
Species: Hu, Mu, Rt
Applications: WB
NB100-2901
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for myozenin 3 Antibody (NBP1-90616) (0)

There are no publications for myozenin 3 Antibody (NBP1-90616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for myozenin 3 Antibody (NBP1-90616) (0)

There are no reviews for myozenin 3 Antibody (NBP1-90616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for myozenin 3 Antibody (NBP1-90616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional myozenin 3 Products

myozenin 3 NBP1-90616

Bioinformatics Tool for myozenin 3 Antibody (NBP1-90616)

Discover related pathways, diseases and genes to myozenin 3 Antibody (NBP1-90616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for myozenin 3 Antibody (NBP1-90616)

Discover more about diseases related to myozenin 3 Antibody (NBP1-90616).
 

Pathways for myozenin 3 Antibody (NBP1-90616)

View related products by pathway.

PTMs for myozenin 3 Antibody (NBP1-90616)

Learn more about PTMs related to myozenin 3 Antibody (NBP1-90616).

Blogs on myozenin 3

There are no specific blogs for myozenin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our myozenin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOZ3