Myosin Phosphatase 2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R12B. Source: E. coli
Amino Acid Sequence: TQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLW Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PPP1R12B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87750. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Myosin Phosphatase 2 Recombinant Protein Antigen
Background
PPP1R12B, also known as Protein phosphatase 1 regulatory subunit 12B, has 5 isoforms, a 982 amino acid isoform that is 110 kDa, a 386 amino acid isoform that is 43 kDa, a 224 amino acid isoform that is 26 kDa, a 208 amino acid isoform that is 24 kDa, and a 515 amino acid isoform that is 58 kDa; detected in skeletal muscle, fetal and adult heart, brain, placenta, kidney, spleen, thymus, pancreas and lung; with cytoplasmatic subcellular location; regulates myosin phosphatase activity and augments Ca(2+) sensitivity of the contractile apparatus. This protein is being studied for its involvement in breast cancer. The PPP1R12B protein has been shown to involve IL16, PPP1CB, PRKG1, HSPA8, MYL6, and MYL6B in RhoA pathway, PKA signaling, actin-based motility by Rho family GTPases, eIF2 pathway, CDK5 pathway, insulin pathway, G2/M transition, cell cycle, mitotic G2-G2/M phases, regulation of PLK1 activity at G2/M transition, cell cycle, mitotic, and vascular smooth muscle contraction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: AC
Publications for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)
There are no publications for Myosin Phosphatase 2 Protein (NBP1-87750PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)
There are no reviews for Myosin Phosphatase 2 Protein (NBP1-87750PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)
Additional Myosin Phosphatase 2 Products
Blogs on Myosin Phosphatase 2