Myosin Phosphatase 2 Recombinant Protein Antigen

Images

 
There are currently no images for Myosin Phosphatase 2 Protein (NBP1-87750PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Myosin Phosphatase 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R12B.

Source: E. coli

Amino Acid Sequence: TQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R12B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87750.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin Phosphatase 2 Recombinant Protein Antigen

  • MGC131980
  • MGC87886
  • Myosin phosphatase target subunit 2
  • myosin phosphatase, target subunit 2
  • Myosin phosphatase-targeting subunit 2
  • MYPT 2
  • MYPT2FLJ40942
  • protein phosphatase 1 regulatory subunit 12B
  • protein phosphatase 1, regulatory (inhibitor) subunit 12B

Background

PPP1R12B, also known as Protein phosphatase 1 regulatory subunit 12B, has 5 isoforms, a 982 amino acid isoform that is 110 kDa, a 386 amino acid isoform that is 43 kDa, a 224 amino acid isoform that is 26 kDa, a 208 amino acid isoform that is 24 kDa, and a 515 amino acid isoform that is 58 kDa; detected in skeletal muscle, fetal and adult heart, brain, placenta, kidney, spleen, thymus, pancreas and lung; with cytoplasmatic subcellular location; regulates myosin phosphatase activity and augments Ca(2+) sensitivity of the contractile apparatus. This protein is being studied for its involvement in breast cancer. The PPP1R12B protein has been shown to involve IL16, PPP1CB, PRKG1, HSPA8, MYL6, and MYL6B in RhoA pathway, PKA signaling, actin-based motility by Rho family GTPases, eIF2 pathway, CDK5 pathway, insulin pathway, G2/M transition, cell cycle, mitotic G2-G2/M phases, regulation of PLK1 activity at G2/M transition, cell cycle, mitotic, and vascular smooth muscle contraction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37897
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
H00026051-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-62682
Species: Hu
Applications: IHC,  IHC-P
H00084988-B01P
Species: Hu
Applications: IHC,  IHC-P, WB
H00009426-M06
Species: Hu
Applications: ELISA, S-ELISA, WB
MAB8306
Species: Hu
Applications: IHC, WB
NBP1-32618
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-80611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
QET00B
Species: Hu
Applications: ELISA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-87750PEP
Species: Hu
Applications: AC

Publications for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)

There are no publications for Myosin Phosphatase 2 Protein (NBP1-87750PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)

There are no reviews for Myosin Phosphatase 2 Protein (NBP1-87750PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin Phosphatase 2 Protein (NBP1-87750PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin Phosphatase 2 Products

Blogs on Myosin Phosphatase 2

There are no specific blogs for Myosin Phosphatase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin Phosphatase 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R12B