Myosin 1B Antibody (3W1C6)

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] - Western blot analysis of various lysates using Myosin 1B Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Western Blot: Myosin 1B Antibody (3W1C6) [NBP3-33271] - Western blot analysis of lysates from Mouse lung, using Myosin 1B Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3W1C6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myosin 1B Antibody (3W1C6) Summary

• Description: Novus Biologicals Rabbit Myosin 1B Antibody (3W1C6) (NBP3-33271) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 916-1136 of Human Myosin 1B (NP_001123630.1).
  
  Sequence:
  RIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MYO1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 132 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myosin 1B Antibody (3W1C6)

• MMIa
• MMI-alpha
• MYH-1c
• MYO1B variant protein
• Myosin I alpha
• myosin IB
• myosin-I alpha
• myosin-Ib
• myr1

Background

Myosin 1B is a motor protein which is involved in neuronal development, membrane trafficking/dynamics and functions including cell migration, vesicular transport and neurite outgrowth. Myosin 1B is known to have interactions with other proteins such as MAP3K3, RIPK3, BRF2, EIF4A2 and CIAO1. Myosin 1B has been studied in relation to neuronitis, amebiasis and dysentery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYO1B