MYO6 Recombinant Protein Antigen

Images

 
There are currently no images for MYO6 Protein (NBP2-38254PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYO6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO6.

Source: E.coli

Amino Acid Sequence: DGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYO6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38254.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MYO6 Recombinant Protein Antigen

  • DFNA22
  • DFNB37
  • KIAA0389deafness, autosomal recessive 37
  • myosin VI
  • myosin-VI
  • Unconventional myosin-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3481
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm
Applications: WB
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
MAB8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-69069
Species: Hu
Applications: IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-55431
Species: Hu
Applications: IHC, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38254PEP
Species: Hu
Applications: AC

Publications for MYO6 Protein (NBP2-38254PEP) (0)

There are no publications for MYO6 Protein (NBP2-38254PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO6 Protein (NBP2-38254PEP) (0)

There are no reviews for MYO6 Protein (NBP2-38254PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYO6 Protein (NBP2-38254PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MYO6 Products

Bioinformatics Tool for MYO6 Protein (NBP2-38254PEP)

Discover related pathways, diseases and genes to MYO6 Protein (NBP2-38254PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO6 Protein (NBP2-38254PEP)

Discover more about diseases related to MYO6 Protein (NBP2-38254PEP).
 

Pathways for MYO6 Protein (NBP2-38254PEP)

View related products by pathway.

PTMs for MYO6 Protein (NBP2-38254PEP)

Learn more about PTMs related to MYO6 Protein (NBP2-38254PEP).

Blogs on MYO6

There are no specific blogs for MYO6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYO6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO6