MYO18A Antibody

Images

 
Immunohistochemistry-Paraffin: MYO18A Antibody [NBP1-83020] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYO18A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO18A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MYO18A Protein (NBP1-83020PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MYO18A Antibody

  • KIAA0216DKFZp686L0243
  • MAJN
  • Molecule associated with JAK3 N-terminus
  • myosin 18A
  • Myosin containing a PDZ domain
  • myosin containing PDZ domain
  • myosin XVIIIA
  • myosin-XVIIIa
  • MysPDZ
  • SP-A receptor subunit SP-R210 alphaS
  • SPR210

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7548
Species: Hu
Applications: IHC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13430
Species: Hu
Applications: IHC, IHC-P
NB300-829
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-83020
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for MYO18A Antibody (NBP1-83020) (0)

There are no publications for MYO18A Antibody (NBP1-83020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO18A Antibody (NBP1-83020) (0)

There are no reviews for MYO18A Antibody (NBP1-83020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MYO18A Antibody (NBP1-83020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYO18A Products

Bioinformatics Tool for MYO18A Antibody (NBP1-83020)

Discover related pathways, diseases and genes to MYO18A Antibody (NBP1-83020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO18A Antibody (NBP1-83020)

Discover more about diseases related to MYO18A Antibody (NBP1-83020).
 

Pathways for MYO18A Antibody (NBP1-83020)

View related products by pathway.

PTMs for MYO18A Antibody (NBP1-83020)

Learn more about PTMs related to MYO18A Antibody (NBP1-83020).

Blogs on MYO18A

There are no specific blogs for MYO18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYO18A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO18A
Entrez
Uniprot