MX2 Antibody

Images

 
Western Blot: MX2 Antibody [NBP2-85341] - Host: Rabbit. Target Name: MX2. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MX2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MX2. Peptide sequence: MMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MX2 Antibody

  • human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB
  • interferon-induced GTP-binding protein Mx2
  • MXB
  • myxovirus (influenza virus) resistance 2 (mouse)
  • myxovirus (influenza) resistance 2, homolog of murine
  • Myxovirus resistance protein 2
  • p78-related protein
  • second interferon-induced protein p78

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32905
Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-78736
Species: Hu
NB120-11899
Species: Mu
Applications: WB, IHC, IHC-Fr
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-40842
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30214
Species: Hu
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for MX2 Antibody (NBP2-85341) (0)

There are no publications for MX2 Antibody (NBP2-85341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MX2 Antibody (NBP2-85341) (0)

There are no reviews for MX2 Antibody (NBP2-85341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MX2 Antibody (NBP2-85341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MX2 Products

Bioinformatics Tool for MX2 Antibody (NBP2-85341)

Discover related pathways, diseases and genes to MX2 Antibody (NBP2-85341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MX2 Antibody (NBP2-85341)

Discover more about diseases related to MX2 Antibody (NBP2-85341).
 

Pathways for MX2 Antibody (NBP2-85341)

View related products by pathway.

PTMs for MX2 Antibody (NBP2-85341)

Learn more about PTMs related to MX2 Antibody (NBP2-85341).

Blogs on MX2

There are no specific blogs for MX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MX2