mu Opioid R/OPRM1 Antibody

Images

 
Western Blot: mu Opioid R/OPMR1 Antibody [H00004988-A01] - Analysis of OPRM1 expression in rat muscle.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

mu Opioid R/OPRM1 Antibody Summary

Immunogen
OPRM1 (NP_000905, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MSDAQLGPLRLTLLSVSARTGFCKKQQELWQRRKEAAEALGTRKVSVLLATSHSGARPAVSTMDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPN
Specificity
OPRM1 - opioid receptor, mu 1
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
OPRM1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mu Opioid R/OPRM1 Antibody

  • hMOP
  • KIAA0403
  • LMOR
  • MOP
  • mOpioidR
  • MOR
  • MOR1
  • M-OR-1
  • MOR-1
  • MOR1MOR
  • Mu opiate receptor
  • mu Opioid R
  • Mu opioid receptor
  • mu-type opioid receptor
  • opioid receptor, mu 1
  • OPRM
  • OPRM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB38951
Species: Hu
Applications: IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21065
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-46466
Species: Hu
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for mu Opioid R/OPRM1 Antibody (H00004988-A01) (0)

There are no publications for mu Opioid R/OPRM1 Antibody (H00004988-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mu Opioid R/OPRM1 Antibody (H00004988-A01) (0)

There are no reviews for mu Opioid R/OPRM1 Antibody (H00004988-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mu Opioid R/OPRM1 Antibody (H00004988-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mu Opioid R/OPRM1 Products

Bioinformatics Tool for mu Opioid R/OPRM1 Antibody (H00004988-A01)

Discover related pathways, diseases and genes to mu Opioid R/OPRM1 Antibody (H00004988-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mu Opioid R/OPRM1 Antibody (H00004988-A01)

Discover more about diseases related to mu Opioid R/OPRM1 Antibody (H00004988-A01).
 

Pathways for mu Opioid R/OPRM1 Antibody (H00004988-A01)

View related products by pathway.

PTMs for mu Opioid R/OPRM1 Antibody (H00004988-A01)

Learn more about PTMs related to mu Opioid R/OPRM1 Antibody (H00004988-A01).
 

Research Areas for mu Opioid R/OPRM1 Antibody (H00004988-A01)

Find related products by research area.

Blogs on mu Opioid R/OPRM1

There are no specific blogs for mu Opioid R/OPRM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mu Opioid R/OPRM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPRM1
Entrez
OMIM
Uniprot