MTRR Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTRR. Source: E. coli
Amino Acid Sequence: GLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASLRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MTRR |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86596. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MTRR Recombinant Protein Antigen
Background
MTRR, also known as Methionine synthase reductase, consists of 3 isoforms, a 725 amino acid isoform 1 that is 80 kDa, a 658 amino acid isoform 2 that is 78 kDa and 58 amino acid isoform 2 that is 6 kDa, cytoplasm located, found in all tissues tested, particularly abundant in skeletal muscle, regenerates a functional methionine synthase via reductive methylation, and it is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Current research is being performed onseveral diseases and disorders including homocystinuria-megaloblastic anemia cbl e type, neural tube defects folate-sensitive, homocystinuria-megaloblastic anemia, neural tube defect, cble, disorders of intracellular cobalamin metabolism, megaloblastic anemia, homocysteine, diffuse large b-cell lymphoma, homocysteine plasma level, cleft lip/palate, age related macular degeneration, deep vein thrombosis, homocystinuria, patent ductus arteriosus, spina bifida, b-cell lymphomas, methylcobalamin deficiency, abdominal aortic aneurysm, hyperhomocysteinemia, and Down syndrome. The protein has been linked to the Antimetabolite Pathway - Folate Cycle, Pharmacodynamics, Methotrexate Pathway (Cancer Cell) Pharmacodynamics, Thiopurine Pathway Pharmacokinetics/Pharmacodynamics, One Carbon Metabolism, Folate Metabolism, Sulfur amino acid metabolism, Biological oxidations, Metabolism of amino acids and derivatives, and Phase II conjugation pathways where it interacts with MMAB, ELAVL1, and UBC proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Publications for MTRR Protein (NBP1-86596PEP) (0)
There are no publications for MTRR Protein (NBP1-86596PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTRR Protein (NBP1-86596PEP) (0)
There are no reviews for MTRR Protein (NBP1-86596PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MTRR Protein (NBP1-86596PEP) (0)
Additional MTRR Products
Research Areas for MTRR Protein (NBP1-86596PEP)
Find related products by research area.
|
Blogs on MTRR