MTRR Antibody (1G7)

Images

 
There are currently no images for MTRR Antibody (H00004552-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTRR Antibody (1G7) Summary

Immunogen
MTRR (NP_002445, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
Localization
Cytoplasmic and Mitochondrial
Specificity
MTRR - 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTRR
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00004552-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTRR Antibody (1G7)

  • [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
  • 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
  • cblE
  • EC 1.16.1.8
  • methionine synthase reductase
  • methionine synthase reductase, mitochondrial
  • MGC129643
  • MSR

Background

Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-71693
Species: Hu
Applications: WB, ICC/IF
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for MTRR Antibody (H00004552-M01)(1)

Reviews for MTRR Antibody (H00004552-M01) (0)

There are no reviews for MTRR Antibody (H00004552-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTRR Antibody (H00004552-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTRR Products

Bioinformatics Tool for MTRR Antibody (H00004552-M01)

Discover related pathways, diseases and genes to MTRR Antibody (H00004552-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTRR Antibody (H00004552-M01)

Discover more about diseases related to MTRR Antibody (H00004552-M01).
 

Pathways for MTRR Antibody (H00004552-M01)

View related products by pathway.

PTMs for MTRR Antibody (H00004552-M01)

Learn more about PTMs related to MTRR Antibody (H00004552-M01).

Blogs on MTRR

There are no specific blogs for MTRR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTRR Antibody (1G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTRR
Entrez
OMIM
Uniprot