MTMR1 Antibody (1F10) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MTMR1 (NP_003819.1, 39 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD |
| Specificity |
MTMR1 - myotubularin related protein 1 (1F10) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MTMR1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MTMR1 Antibody (1F10) - Azide and BSA Free
Background
This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Mu
Applications: ELISA, IHC, IP, KD, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for MTMR1 Antibody (H00008776-M01) (0)
There are no publications for MTMR1 Antibody (H00008776-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTMR1 Antibody (H00008776-M01) (0)
There are no reviews for MTMR1 Antibody (H00008776-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MTMR1 Antibody (H00008776-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MTMR1 Products
Blogs on MTMR1