MTMR1 Antibody (1F10)


Western Blot: MTMR1 Antibody (1F10) [H00008776-M01] - Analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody (M01), clone 1F10.Lane 1: MTMR1 transfected lysate(39.8 KDa).Lane 2: more
Sandwich ELISA: MTMR1 Antibody (1F10) [H00008776-M01] - Detection limit for recombinant GST tagged MTMR1 is 0.3 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

MTMR1 Antibody (1F10) Summary

MTMR1 (NP_003819.1, 39 a.a. - 112 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD
MTMR1 - myotubularin related protein 1 (1F10)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTMR1 Antibody (1F10)

  • EC 3.1.3
  • EC 3.1.3.-
  • EC
  • myotubularin related protein 1
  • myotubularin-related protein 1


This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
Species: Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MTMR1 Antibody (H00008776-M01) (0)

There are no publications for MTMR1 Antibody (H00008776-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR1 Antibody (H00008776-M01) (0)

There are no reviews for MTMR1 Antibody (H00008776-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTMR1 Antibody (H00008776-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MTMR1 Products

Bioinformatics Tool for MTMR1 Antibody (H00008776-M01)

Discover related pathways, diseases and genes to MTMR1 Antibody (H00008776-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTMR1 Antibody (H00008776-M01)

Discover more about diseases related to MTMR1 Antibody (H00008776-M01).

Pathways for MTMR1 Antibody (H00008776-M01)

View related products by pathway.

PTMs for MTMR1 Antibody (H00008776-M01)

Learn more about PTMs related to MTMR1 Antibody (H00008776-M01).

Blogs on MTMR1

There are no specific blogs for MTMR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MTMR1 Antibody (1F10) and receive a gift card or discount.


Gene Symbol MTMR1