MTMR1 Antibody (1F10) - Azide and BSA Free

Western Blot: MTMR1 Antibody (1F10) [H00008776-M01] - Analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody (M01), clone 1F10.Lane 1: MTMR1 transfected lysate(39.8 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: MTMR1 Antibody (1F10) [H00008776-M01] - Detection limit for recombinant GST tagged MTMR1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MTMR1 Antibody (1F10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MTMR1 (NP_003819.1, 39 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD
• Specificity: MTMR1 - myotubularin related protein 1 (1F10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MTMR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTMR1 Antibody (1F10) - Azide and BSA Free

• EC 3.1.3
• EC 3.1.3.-
• EC 3.1.3.48
• myotubularin related protein 1
• myotubularin-related protein 1

Background

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTMR1
• Entrez:
  • 8776(Human)
• Uniprot:
  • NP_003819(Human)