![Western Blot: MTAP Antibody [NBP2-56796] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/MTAP Antibody-Western Blot-NBP2-56796-img0002.jpg "Western Blot: MTAP Antibody [NBP2-56796] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR |
| Specificity | Specificity of human MTAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MTAP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for MTAP Antibody (NBP2-56796)Discover more about diseases related to MTAP Antibody (NBP2-56796).
| Pathways for MTAP Antibody (NBP2-56796)View related products by pathway.
|
PTMs for MTAP Antibody (NBP2-56796)Learn more about PTMs related to MTAP Antibody (NBP2-56796).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MTAP |
![Immunocytochemistry/Immunofluorescence: MTAP Antibody [NBP2-56796] - Staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize2/MTAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56796-img0001.jpg "Immunocytochemistry/Immunofluorescence: MTAP Antibody [NBP2-56796] - Staining of human cell line U-251 MG shows localization to cytosol.")
![Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.](http://images.novusbio.com/images2/p16INK4a-CDKN2A-Antibody-Western-Blot-NB200-106-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0004.jpg)
![Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/images2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/images2/SUB1-Antibody-Western-Blot-NBP1-82454-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/images2/SUB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82454-img0011.jpg)
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/images2/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0015.jpg)
![Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Analysis in human cell lines HEK293 and SK-MEL-30 using Anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.](http://images.novusbio.com/images2/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Western-Blot-NBP1-82541-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining of human cell line RPTEC TERT1 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82541-img0022.jpg)
![Immunohistochemistry-Paraffin: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-82541] - Staining in human epididymis and testis tissues using anti-PNP antibody. Corresponding PNP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Purine-Nucleoside-Phosphorylase-PNP-Antibody-Immunohistochemistry-Paraffin-NBP1-82541-img0020.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of NXT1 expression in transfected 293T cell line by NXT1 monoclonal antibody (M08), clone 4F11. Lane 1: NXT1 transfected lysatE (15.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/NXT1 Antibody (4F11)-Western Blot-H00029107-M08-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: NXT1 Antibody (4F11) [H00029107-M08] - Analysis of monoclonal antibody to NXT1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/NXT1-Antibody-(4F11)-Immunocytochemistry-Immunofluorescence-H00029107-M08-img0004.jpg)
![Western Blot: NXT1 Antibody (4F11) [H00029107-M08] - Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi or non-transfected control. Blot probed with H00029107-M08. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/images2/NXT1-Antibody-(4F11)-Western-Blot-H00029107-M08-img0002.jpg)
![Western Blot: MRPL28 Antibody [NBP1-82805] - Analysis using Anti-MRPL28 antibody NBP1-82805 (A) shows similar pattern to independent antibody NBP2-38760 (B).](http://images.novusbio.com/images2/MRPL28 Antibody-Western Blot-NBP1-82805-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/images2/MRPL28-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82805-img0006.jpg)
![Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/MRPL28-Antibody-Immunohistochemistry-Paraffin-NBP1-82805-img0002.jpg)
![Western Blot: APRT Antibody [NBP1-89519] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-41](http://images.novusbio.com/images2/APRT-Antibody-Western-Blot-NBP1-89519-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: APRT Antibody [NBP1-89519] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/images2/APRT Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89519-img0006.jpg)
![Immunohistochemistry-Paraffin: APRT Antibody [NBP1-89519] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.](http://images.novusbio.com/images2/APRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89519-img0002.jpg)
![Western Blot: Cdk2 Antibody (2D9) [NBP2-00776] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cdk2 monoclonal antibody.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Western Blot-NBP2-00776-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cdk2.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Immunocytochemistry-Immunofluorescence-NBP2-00776-img0007.jpg)
![Immunohistochemistry-Paraffin: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-Cdk2 mouse monoclonal antibody.](http://images.novusbio.com/images/Cdk2 Antibody (2D9)-Immunohistochemistry-Paraffin-NBP2-00776-img0006.jpg)
![Western Blot: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Analysis using the Azide and BSA Free version of NBP2-32887. Detection of ODC1 in human placental lysate](http://images.novusbio.com/images2/Ornithine-Decarboxylase-Antibody-(ODC1-485)-Western-Blot-NBP2-32887-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - IF staining of LNCap cells using AF488 labeled ODC1 Monoclonal Antibody (ODC1/485) (GREEN) DAPI was used to stain the cell nucleus (blue). Image using the Azide and BSA Free format of this antibody.](http://images.novusbio.com/images2/Ornithine-Decarboxylase-Antibody-(ODC1-485)-Immunocytochemistry-Immunofluorescence-NBP2-32887-img0014.jpg)
![Immunohistochemistry-Paraffin: Ornithine Decarboxylase Antibody (ODC1/485) [NBP2-32887] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with Ornithine Decarboxylase Antibody (ODC1/485).](http://images.novusbio.com/images2/Ornithine-Decarboxylase-Antibody-(ODC1-485)-Immunohistochemistry-Paraffin-NBP2-32887-img0012.jpg)
![Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Western-Blot-NBP2-75930-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-75930-img0004.jpg)
![Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/IFN-alpha-1-Antibody-Immunohistochemistry-Paraffin-NBP2-75930-img0007.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0013.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/images2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![IFN-beta [Biotin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IFN-beta [Biotin]")
![Immunohistochemistry-Paraffin: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Staining of paraffin embedded Human Intestine with antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/Pancreatic-Polypeptide-PP-Antibody-Immunohistochemistry-Paraffin-NB100-1793-img0009.jpg)
![Flow Cytometry: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Flow cytometric analysis of paraformaldehyde fixed U2OS cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/Pancreatic-Polypeptide-PP-Antibody-Flow-Cytometry-NB100-1793-img0010.jpg)
![Immunohistochemistry-Frozen: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Analysis of Pancreatic Polypeptide in mouse adult pancreas tissue. IHC-Fr image submitted by a verified customer review.](http://images.novusbio.com/images2/Pancreatic-Polypeptide-PP-Antibody-Immunohistochemistry-Frozen-NB100-1793-img0004.jpg)
![Western Blot: ADK Antibody [NBP2-15291] - Mouse tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with Adenosine kinase antibody diluted by 1:1500.](http://images.novusbio.com/images2/ADK-Antibody-Western-Blot-NBP2-15291-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: ADK Antibody [NBP2-15291] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.](http://images.novusbio.com/images2/ADK-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-15291-img0005.jpg)
![Immunohistochemistry-Paraffin: ADK Antibody [NBP2-15291] - Paraffin-embedded mouse kidney. Adenosine kinase antibody dilution: 1:500.](http://images.novusbio.com/images2/ADK-Antibody-Immunohistochemistry-Paraffin-NBP2-15291-img0010.jpg)
![Western Blot: IFN-alpha I/IFNA17 Antibody [H00003451-D01P] - Analysis of IFNA17 expression in rat brain.](http://images.novusbio.com/images2/IFN-alpha-I-IFNA17-Antibody-Western-Blot-H00003451-D01P-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: IFN-alpha I/IFNA17 Antibody [H00003451-D01P] - Analysis of antibody to IFNA17 on HeLa cell. Antibody concentration 30 ug/ml.](http://images.novusbio.com/images2/IFN-alpha-I-IFNA17-Antibody-Immunocytochemistry-Immunofluorescence-H00003451-D01P-img0003.jpg)
![Western Blot: IFN-alpha I/IFNA17 Antibody [H00003451-D01P] - Analysis of IFNA17 expression in transfected 293T cell line by IFNA17 polyclonal antibody.Lane 1: IFNA17 transfected lysate(21.70 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/IFN-alpha I-IFNA17 Antibody-Western Blot-H00003451-D01P-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")