MTAP Antibody

Images

 
Western Blot: MTAP Antibody [NBP2-56796] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MTAP Antibody [NBP2-56796] - Staining of human cell line U-251 MG shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR
Specificity
Specificity of human MTAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTAP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
MTAP Knockout HeLa Cell Lysate
Control Peptide
MTAP Recombinant Protein Antigen (NBP2-56796PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MTAP Antibody

  • 5'-methylthioadenosine phosphorylase
  • BDMF
  • C86fus
  • DMSFH
  • DMSMFH
  • EC 2.4.2.28
  • HEL-249
  • LGMBF
  • methylthioadenosine phosphorylase
  • MSAPMeSAdo phosphorylase
  • MTA phosphorylase
  • MTAP
  • MTAPase
  • S-methyl-5'-thioadenosine phosphorylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1793
Species: Hu, Mu, Rt, Pm
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for MTAP Antibody (NBP2-56796) (0)

There are no publications for MTAP Antibody (NBP2-56796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTAP Antibody (NBP2-56796) (0)

There are no reviews for MTAP Antibody (NBP2-56796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTAP Antibody (NBP2-56796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MTAP Products

Bioinformatics Tool for MTAP Antibody (NBP2-56796)

Discover related pathways, diseases and genes to MTAP Antibody (NBP2-56796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTAP Antibody (NBP2-56796)

Discover more about diseases related to MTAP Antibody (NBP2-56796).
 

Pathways for MTAP Antibody (NBP2-56796)

View related products by pathway.

PTMs for MTAP Antibody (NBP2-56796)

Learn more about PTMs related to MTAP Antibody (NBP2-56796).

Blogs on MTAP

There are no specific blogs for MTAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTAP