Recombinant Human MSY2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MSY2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-364 of Human YBX2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEVEAAAVATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
YBX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSY2 Protein

  • Contrin
  • CSDA3MGC45104
  • DBPC
  • DNA-binding protein C
  • Germ cell-specific Y-box-binding protein
  • MSY2 homolog
  • MSY2germ cell specific Y-box binding protein
  • Y box binding protein 2
  • Y-box-binding protein 2

Background

YBX2 is a germ-cell specific member of the vertebrate Y box family of nucleic acid-binding proteins (Gu et al., 1998 [PubMed 9780336]; Tekur et al., 1999 [PubMed 10100484]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-32780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67354
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6548
Species: Hu, Mu
Applications: IHC
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00344018-P01
Species: Hu
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2566
Species: Mu
Applications: WB, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00051087-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MSY2 Recombinant Protein (H00051087-P01) (0)

There are no publications for MSY2 Recombinant Protein (H00051087-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSY2 Recombinant Protein (H00051087-P01) (0)

There are no reviews for MSY2 Recombinant Protein (H00051087-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSY2 Recombinant Protein (H00051087-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MSY2 Recombinant Protein (H00051087-P01)

Discover related pathways, diseases and genes to MSY2 Recombinant Protein (H00051087-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSY2 Recombinant Protein (H00051087-P01)

Discover more about diseases related to MSY2 Recombinant Protein (H00051087-P01).
 

Pathways for MSY2 Recombinant Protein (H00051087-P01)

View related products by pathway.

PTMs for MSY2 Recombinant Protein (H00051087-P01)

Learn more about PTMs related to MSY2 Recombinant Protein (H00051087-P01).

Blogs on MSY2

There are no specific blogs for MSY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCP1 Antibody
NB300-229
MSY2 Antibody
NBP2-19422
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSY2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol YBX2