MST4 Recombinant Protein Antigen

Images

 
There are currently no images for MST4 Protein (NBP2-38882PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MST4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MST4.

Source: E. coli

Amino Acid Sequence: GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38882. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MST4 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 4
  • mammalian sterile 20-like 4
  • MASK
  • Mst3 and SOK1-related kinase
  • MST-4
  • serine/threonine protein kinase MASK
  • serine/threonine protein kinase MST4
  • Serine/threonine-protein kinase MASK
  • serine/threonine-protein kinase MST4
  • STE20-like kinase MST4

Background

Novel human Ste20-related kinase Mst4 is highly expressed in placenta, thymus, and peripheral blood leukocytes. Mst4 is biologically active in the activation of MEK/ERK pathway and in mediating cell growth and transformation (1). Wild type and C-terminally truncated forms of Mst4 can both induce apoptosis upon overexpression in mammalian cells that is abrogated by CrmA, suggesting involvement of Mst4 in the apoptotic machinery in mammalian cells (2). Mst4 was found to be expressed in prostate carcinoma tumor samples and cell lines. In addition, expression levels appeared to correlate with tumorigenicity and androgen receptor status of the cells. Mst4 kinase activity was stimulated significantly by epidermal growth factor receptor ligands, which are known to promote growth of prostate cancer cells (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-93073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010494-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
H00006583-A01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83024
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-15658
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-38882PEP
Species: Hu
Applications: AC

Publications for MST4 Protein (NBP2-38882PEP) (0)

There are no publications for MST4 Protein (NBP2-38882PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST4 Protein (NBP2-38882PEP) (0)

There are no reviews for MST4 Protein (NBP2-38882PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MST4 Protein (NBP2-38882PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MST4 Products

Research Areas for MST4 Protein (NBP2-38882PEP)

Find related products by research area.

Blogs on MST4

There are no specific blogs for MST4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MST4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK26