MST4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MST4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MST4.
  
  

  Source: E. coli

  Amino Acid Sequence: GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: STK26
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38882.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MST4 Recombinant Protein Antigen

• EC 2.7.11
• EC 2.7.11.1
• Mammalian STE20-like protein kinase 4
• mammalian sterile 20-like 4
• MASK
• Mst3 and SOK1-related kinase
• MST-4
• serine/threonine protein kinase MASK
• serine/threonine protein kinase MST4
• Serine/threonine-protein kinase MASK
• serine/threonine-protein kinase MST4
• STE20-like kinase MST4

Background

Novel human Ste20-related kinase Mst4 is highly expressed in placenta, thymus, and peripheral blood leukocytes. Mst4 is biologically active in the activation of MEK/ERK pathway and in mediating cell growth and transformation (1). Wild type and C-terminally truncated forms of Mst4 can both induce apoptosis upon overexpression in mammalian cells that is abrogated by CrmA, suggesting involvement of Mst4 in the apoptotic machinery in mammalian cells (2). Mst4 was found to be expressed in prostate carcinoma tumor samples and cell lines. In addition, expression levels appeared to correlate with tumorigenicity and androgen receptor status of the cells. Mst4 kinase activity was stimulated significantly by epidermal growth factor receptor ligands, which are known to promote growth of prostate cancer cells (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: STK26