We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MST2/STK3 Recombinant Protein Antigen

Images

 
There are currently no images for MST2/STK3 Protein (NBP1-89586PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MST2/STK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK3.

Source: E. coli

Amino Acid Sequence: ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89586.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MST2/STK3 Recombinant Protein Antigen

  • EC 2.7.11
  • FLJ90748
  • KRS1
  • Mammalian STE20-like protein kinase 2
  • Mess1
  • MST2
  • MST-2
  • MST2EC 2.7.11.1
  • MST3
  • serine/threonine kinase 3 (STE20 homolog, yeast)
  • serine/threonine kinase 3 (Ste20, yeast homolog)
  • serine/threonine kinase 3
  • serine/threonine-protein kinase 3
  • Serine/threonine-protein kinase Krs-1
  • STE20-like kinase MST2
  • STK3

Background

Mammalian Sterile 20-Like 2 (Mst2) is most similar to the previously identified Mst1 protein kinase (78% identity, 88% similarity). Northern analysis indicates that MST2 mRNA is expressed at high levels in adult kidney, skeletal and placental tissues and at very low levels in adult heart, lung, liver and brain tissues. An in-vitro kinase assay indicates that Mst2 can phosphorylate an exogenous substrate, as well as itself, and phospho-amino-acid analysis indicates that it is a serine/threonine protein kinase (1) Mst2, a STE20-family member and purported Hpo ortholog, phosphorylates and activates both Lats1 and Lats2. Results indicate that Mst2-like kinases regulate Lats kinase activities in an evolutionarily conserved regulatory pathway (2). When stably expressed in HeLa cells, Mst highly sensitizes the cells to death receptor-mediated apoptosis by accelerating caspase-3 activation. These findings suggest that Mst1 and Mst2 play a role in apoptosis both upstream and downstream of caspase activation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
352-MS
Species: Hu
Applications: BA
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-82617
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5066
Species: Hu
Applications: WB
NBP2-33860
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-197
Species: Hu, Mu
Applications: IP, WB
NBP1-81763
Species: Hu
Applications: IHC,  IHC-P
NBP2-73041
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, WB
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB7940
Species: Hu
Applications: IHC, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46037
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, , WB
NBP1-92435
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32181
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MST2/STK3 Protein (NBP1-89586PEP) (0)

There are no publications for MST2/STK3 Protein (NBP1-89586PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST2/STK3 Protein (NBP1-89586PEP) (0)

There are no reviews for MST2/STK3 Protein (NBP1-89586PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MST2/STK3 Protein (NBP1-89586PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MST2/STK3 Products

Research Areas for MST2/STK3 Protein (NBP1-89586PEP)

Find related products by research area.

Blogs on MST2/STK3

There are no specific blogs for MST2/STK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MST2/STK3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK3