We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human MSK1/RPS6KA5 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MSK1/RPS6KA5 Protein [H00009252-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human MSK1/RPS6KA5 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 372-470 of Human MSK1/RPS6KA5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEIT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RPS6KA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSK1/RPS6KA5 GST (N-Term) Protein

  • EC 2.7.11
  • MGC1911,90 kDa ribosomal protein S6 kinase 5
  • MSK1
  • MSK1EC 2.7.11.1
  • MSPK1
  • Nuclear mitogen- and stress-activated protein kinase 1
  • ribosomal protein S6 kinase alpha-5
  • ribosomal protein S6 kinase, 90kD, polypeptide 5
  • ribosomal protein S6 kinase, 90kDa, polypeptide 5
  • RLPK
  • RPS6KA5
  • RSKL
  • RSK-like protein kinase
  • S6K-alpha-5

Background

MSK-1 is a mitogen and stress activated protein kinase-1 which belongs to the AGC family of kinases and is related in structure to the ribosomal p70 S6 kinase subfamily. MSK-1can be activated by ERK1/2 and SAPK2 /p38 MAP kinase. It is also known to be required for the phosphorylation of CREB, ATF1 H3 and HMG-14 in response to mitogen and stress (1-2). Similar to RSK, MSK-1 contains two kinase domains (N-term and a C-term) (3). Once phosphorylated on Thr581 and Ser360 by ERK1/2 and SAPK2/p38, MSK-1 autophosphorylate on at least 5 sites. Of these autophosphorylation sites Ser212 and Ser376 get phosphorylated by the C-terminal kinase domain of MSK-1 which is essential for the catalytic activity of the N-terminal kinase domain (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF189
Species: Hu, Mu
Applications: IHC, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB79671
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
H00009252-Q02
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02) (0)

There are no publications for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02) (0)

There are no reviews for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSK1/RPS6KA5 Products

Research Areas for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q02)

Find related products by research area.

Blogs on MSK1/RPS6KA5

There are no specific blogs for MSK1/RPS6KA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSK1/RPS6KA5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA5