MRPS36 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS36. Source: E.coli Amino Acid Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MRPS36 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP2-58391 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here. |
| Theoretical MW |
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for MRPS36 Recombinant Protein Antigen
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Publications for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP) (0)
There are no publications for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP) (0)
There are no reviews for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
FAQs for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP) (0)
Additional Array Products
Bioinformatics Tool for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP)
Discover related pathways, diseases and genes to MRPS36 Recombinant Protein Antigen (NBP2-58391PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Pathways for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP)
View related products by pathway.
|
Research Areas for MRPS36 Recombinant Protein Antigen (NBP2-58391PEP)
Find related products by research area.
|
Blogs on MRPS36
![Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).](http://images.novusbio.com/fullsize2/p21-CIP1-CDKN1A-Antibody-(WA-1-(HJ21))-Immunohistochemistry-Paraffin-NBP2-29463-img0001.jpg)
![Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3. Analysis of RPS5 expression in NIH/3T3.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Western-Blot-H00006193-M02-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: RPS5 Antibody (4H3) [H00006193-M02] - Analysis of monoclonal antibody to RPS5 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Immunocytochemistry-Immunofluorescence-H00006193-M02-img0008.jpg)
![Western Blot: RPS5 Antibody (4H3) [H00006193-M02] - RPS5 monoclonal antibody (M02), clone 4H3 Analysis of RPS5 expression in HeLa.](http://images.novusbio.com/fullsize2/RPS5-Antibody-(4H3)-Western-Blot-H00006193-M02-img0010.jpg)
![Western Blot: RPS9 Antibody [NBP2-22298] - Whole cell lysate from HeLa (15 and 50 ug), 293T (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22298 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/RPS9-Antibody-Western-Blot-NBP2-22298-img0001.jpg)
![Immunohistochemistry: RPS9 Antibody [NBP2-22298] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- RPS9 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/fullsize2/RPS9-Antibody-Immunohistochemistry-NBP2-22298-img0006.jpg)
![Western Blot: RPS10 Antibody [NBP1-31357] - Sample (30 ug of whole cell lysate) A: A431 12% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/RPS10 Antibody-Western Blot-NBP1-31357-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP1-31357] - Analysis of HeLa, using NBP1-31357 at 1:200 dilution.](http://images.novusbio.com/fullsize2/RPS10 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31357-img0003.jpg)
![Immunohistochemistry-Paraffin: RPS10 Antibody [NBP1-31357] - Paraffin-embedded mouse colon diluted at 1:500.](http://images.novusbio.com/fullsize2/RPS10-Antibody-Immunohistochemistry-Paraffin-NBP1-31357-img0008.jpg)
![Western Blot: PSMD11 Antibody [NBP1-46191] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Affinity purified rabbit anti-PSMD11 antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. PSMD11 was also immunoprecipitated by rabbit anti-PSMD11 antibody NBP1-46192, which recognizes a downstream epitope.](http://images.novusbio.com/fullsize2/PSMD11-Antibody-Western-Blot-NBP1-46191-img0002.jpg)
![Western Blot: PSMD6 Antibody [NBP1-81545] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/PSMD6-Antibody-Western-Blot-NBP1-81545-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.](http://images.novusbio.com/fullsize2/PSMD6 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81545-img0007.jpg)
![Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/PSMD6-Antibody-Immunohistochemistry-Paraffin-NBP1-81545-img0002.jpg)
![Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000](http://images.novusbio.com/fullsize2/SUG1-Antibody-(25D5)-Western-Blot-NB100-345-img0002.jpg)
![Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of Human RPS6 on HeLa whole cell lysate using NB100-1595. RPS6 was also immunoprecipitated using rabbit anti-RPS6 antibodies NB100-1594 and another RPS6 Ab.](http://images.novusbio.com/fullsize2/Ribosomal-Protein-S6-RPS6-Antibody-Western-Blot-NB100-1595-img0001.jpg)
![Immunohistochemistry: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RPS6 used at a dilution of 1:200 (1ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/Ribosomal Protein S6-RPS6 Antibody-Immunohistochemistry-NB100-1595-img0006.jpg)
![Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize2/Tbp7 Antibody-Western Blot-NBP1-87799-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: Tbp7 Antibody [NBP1-87799] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/Tbp7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87799-img0009.jpg)
![Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/Tbp7-Antibody-Immunohistochemistry-Paraffin-NBP1-87799-img0001.jpg)
![Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Western Blot-NBP2-01808-img0005.jpg)
![Flow Cytometry: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Flow Cytometry-NBP2-01808-img0003.jpg)
![Western Blot: Proteasome 19S S3 Antibody (2A2) [NBP2-01808] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 19S S3.](http://images.novusbio.com/fullsize/Proteasome 19S S3 Antibody (2A2)-Western Blot-NBP2-01808-img0004.jpg)
![Western Blot: MRPL42 Antibody (3H6G11) [NBP2-37393] - Western blot analysis using MRPL42 mouse mAb against HL7702 (1), HepG2 (2), SMMC-7721 (3), HEK293 (4), HeLa (5), and Raji (6) cell lysate.](http://images.novusbio.com/fullsize2/MRPL42-Antibody-(3H6G11)-Western-Blot-NBP2-37393-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: MRPL42 Antibody (3H6G11) [NBP2-37393] - Immunofluorescence analysis of HeLa cells using MRPL42 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.](http://images.novusbio.com/fullsize2/MRPL42-Antibody-(3H6G11)-Immunocytochemistry-Immunofluorescence-NBP2-37393-img0005.jpg)
![Immunohistochemistry: MRPL42 Antibody (3H6G11) [NBP2-37393] - Immunohistochemical analysis of paraffin-embedded esophageal cancer tissues using MRPL42 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/MRPL42-Antibody-(3H6G11)-Immunohistochemistry-NBP2-37393-img0008.jpg)
![Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in Raw 264.7 (Cat # L024V1).](http://images.novusbio.com/fullsize2/RPS7-Antibody-(3G4)-Western-Blot-H00006201-M03-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on HeLa cell. Antibody concentration 20 ug/ml](http://images.novusbio.com/fullsize2/RPS7-Antibody-(3G4)-Immunocytochemistry-Immunofluorescence-H00006201-M03-img0009.jpg)
![Immunohistochemistry-Paraffin: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize2/RPS7-Antibody-(3G4)-Immunohistochemistry-Paraffin-H00006201-M03-img0010.jpg)
![Western Blot: RPS12 Antibody [NBP2-58885] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize2/RPS12 Antibody-Western Blot-NBP2-58885-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: RPS12 Antibody [NBP2-58885] - Staining of human cell line U-251 MG shows localization to cytosol.](http://images.novusbio.com/fullsize2/RPS12-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58885-img0001.jpg)
![Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/Proteasome-19S-S7-Antibody-Western-Blot-NBP1-87797-img0008.jpg)
![Immunohistochemistry-Paraffin: Proteasome 19S S7 Antibody [NBP1-87797] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize2/Proteasome 19S S7 Antibody-Immunohistochemistry-Paraffin-NBP1-87797-img0009.jpg)
![Western Blot: Proteasome 19S S7 Antibody [NBP1-87797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Proteasome-19S-S7-Antibody-Western-Blot-NBP1-87797-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RPS13 Antibody [NBP1-92350] - Staining of human cell line HEK 293 shows localization to endoplasmic reticulum.](http://images.novusbio.com/fullsize2/RPS13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92350-img0007.jpg)
![Immunohistochemistry-Paraffin: RPS13 Antibody [NBP1-92350] - Staining of human stomach shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RPS13-Antibody-Immunohistochemistry-Paraffin-NBP1-92350-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RPS13 Antibody [NBP1-92350] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.](http://images.novusbio.com/fullsize2/RPS13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92350-img0005.jpg)
![Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize2/PSMC1 Antibody-Western Blot-NBP1-80959-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/PSMC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80959-img0008.jpg)
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0012.jpg)
![Western Blot: RPS11 Antibody [NBP2-22288] - Whole cell lysate from 293T (15 and 50 ug), HeLa (50 ug), Jurkat (50 ug), and mouse NIH3T3 (50 ug) cells. NBP2-22288 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.](http://images.novusbio.com/fullsize2/RPS11-Antibody-Western-Blot-NBP2-22288-img0001.jpg)
![Immunohistochemistry: RPS11 Antibody [NBP2-22288] - Samples: FFPE serial sections of human breast carcinoma. Antibody: Affinity purified rabbit anti- RPS11 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/fullsize2/RPS11-Antibody-Immunohistochemistry-NBP2-22288-img0005.jpg)
![Immunohistochemistry-Paraffin: RPS11 Antibody [NBP2-22288] - FFPE serial sections of human breast carcinoma. Antibody: Affinity purified rabbit anti-RPS11 (Cat. No. NBP2-22288, left image and Cat. No. NBP2-22289, right image) used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).](http://images.novusbio.com/fullsize2/RPS11-Antibody-Immunohistochemistry-Paraffin-NBP2-22288-img0004.jpg)
![Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).](http://images.novusbio.com/images2/p21-CIP1-CDKN1A-Antibody-(WA-1-(HJ21))-Immunohistochemistry-Paraffin-NBP2-29463-img0001.jpg "Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).")
![Western Blot: MRPS36 Antibody [NBP1-85286] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-357](http://images.novusbio.com/images2/MRPS36-Antibody-Western-Blot-NBP1-85286-img0005.jpg "Western Blot: MRPS36 Antibody [NBP1-85286] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-357")
![Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of Human RPS6 on HeLa whole cell lysate using NB100-1595. RPS6 was also immunoprecipitated using rabbit anti-RPS6 antibodies NB100-1594 and another RPS6 Ab.](http://images.novusbio.com/images2/Ribosomal-Protein-S6-RPS6-Antibody-Western-Blot-NB100-1595-img0001.jpg "Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of Human RPS6 on HeLa whole cell lysate using NB100-1595. RPS6 was also immunoprecipitated using rabbit anti-RPS6 antibodies NB100-1594 and another RPS6 Ab.")