MRPS28 Antibody - Azide and BSA Free

Western Blot: MRPS28 Antibody [H00028957-B01P] - Analysis of MRPS28 expression in transfected 293T cell line by MRPS28 polyclonal antibody. Lane 1: MRPS28 transfected lysate(20.57 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPS28 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MRPS28 Antibody - Azide and BSA Free (H00028957-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MRPS28 (NP_054737.1, 1 a.a. - 187 a.a.) full-length human protein. MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
• Specificity: Reacts with mitochondrial ribosomal protein S28.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPS28
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS28 Antibody - Azide and BSA Free

• 28S ribosomal protein S35, mitochondrial
• FLJ22853
• mitochondrial 28S ribosomal protein S35
• mitochondrial ribosomal protein S28
• MRP-S2828S ribosomal protein S28, mitochondrial
• MRP-S35
• MRPS35HSPC007
• S28mt
• S35mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS28
• Entrez:
  • 28957(Human)
• Uniprot:
  • NP_054737.1(Human)