MRPL50 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MRPL50 Antibody - BSA Free (NBP2-85322) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL50. Peptide sequence: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL50 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MRPL50 Antibody - BSA Free
Background
MRPL50, also known as Mitochondrial Ribosomal Protein L50, consists of a 158 amino acid isoform that is 18 kDa, and is involved in the process of synthesizing proteins within the mitochondria. There is currently no research being conducted on the relationship between MRPL50 and any diseases. The protein interacts with ICT1, AARS2, AASS, ABCB7, and ACAD9, but is not linked to any biological processes or pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Pl, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for MRPL50 Antibody (NBP2-85322) (0)
There are no publications for MRPL50 Antibody (NBP2-85322).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL50 Antibody (NBP2-85322) (0)
There are no reviews for MRPL50 Antibody (NBP2-85322).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL50 Antibody (NBP2-85322) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL50 Products
Blogs on MRPL50