MRPL49 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MRPL49 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL49.
  
  

  Source: E. coli

  Amino Acid Sequence: GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MRPL49
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13618.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPL49 Recombinant Protein Antigen

• C11orf4
• L49mt39S ribosomal protein L49, mitochondrial
• mitochondrial ribosomal protein L49
• MRP-L49
• Neighbor of FAU
• next to FAU
• NOF1chromosome 11 open reading frame 4
• NOFMGC10656
• Protein NOF1

Background

MRPL49, or Mitochondrial Ribosomal Protein L49, consists of a 166 amino acid isoform that is 19 kDa, and is broadly associated with mitochondrial protein synthesis, though its specific function is still being researched. Current disease research is determining the relationship between MRPL49 and a variety of diseases and disorders, including glossopharyngeal neuralgia, osteoarthritis, ossifying fibroma, osteoporosis, and thoracic outlet syndrome. The protein has been linked to translation, and interacts with ICT1, OXA1L, SlC2A4, AARS2, and AASS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MRPL49