Novus Biologicals products are now on bio-techne.com

MRPL3 Antibody

Images

 
Immunohistochemistry-Paraffin: MRPL3 Antibody [NBP2-55722] - Immunohistochemical staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL3 Recombinant Protein Antigen (NBP2-55722PEP)

Reactivity Notes

Mouse 83%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRPL3 Antibody

  • 39S ribosomal protein L3, mitochondrial
  • mitochondrial ribosomal protein L3
  • MRL3mitochondrial, L3
  • RPML3

Background

MRPL3, also known as 39 S ribosomal protein L3, mitochondrial, is a 38.6 kDa, 348 amino acid protein that, when defected, causes a mitochondrial disease that results poor health, mental retardation, and, in some cases, death in infancy. Current research is observing the effects of the protein on diseases and disorders such as pneumonia, cardiomyopathy, mycobacterium tuberculosis, and malaria. The protein interacts with other proteins such as PUS1, DAP3, ICT1, MRPL13, and MRPL2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP2-81919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
H00000104-P01
Species: Hu
Applications: ELISA, AP, IHC, KA, PA, WB
NBP2-47348
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-74210
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, WB
NBP2-43792
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32174
Species: Dr, Hu
Applications: ICC/IF, WB
NBP1-87730
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-03349
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
H00051264-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88570
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55722
Species: Hu
Applications: IHC

Publications for MRPL3 Antibody (NBP2-55722) (0)

There are no publications for MRPL3 Antibody (NBP2-55722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL3 Antibody (NBP2-55722) (0)

There are no reviews for MRPL3 Antibody (NBP2-55722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPL3 Antibody (NBP2-55722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL3