MRG15 Antibody [mFluor Violet 500 SE]

Product Discontinued

MRG15 Antibody [mFluor Violet 500 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MRG15 (NP_006782.1).
  
  Sequence:
  MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MORF4L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MRG15 Antibody [mFluor Violet 500 SE]

• Eaf3
• Esa1p-associated factor 3 homolog
• HsT17725
• MEAF3
• MGC10631
• MORF-related gene on chromosome 15
• MORFRG15
• mortality factor 4 like 1
• mortality factor 4-like protein 1
• MRG15MORF-related gene 15 protein
• Protein MSL3-1
• S863-6
• Transcription factor-like protein MRG15

Background

MRG15 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MORF4L1