Description | CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
CoraFluor(TM) 1, amine reactive CoraFluor(TM) 1, thiol reactive For more information, please see our CoraFluor(TM) TR-FRET technology flyer. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MRG15 (NP_006782.1). Sequence: MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MORF4L1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. Do not freeze. |
Buffer | PBS |
Preservative | No Preservative |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MRG15 Antibody (NBP3-38377CL1)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MORF4L1 |