Recombinant Human MPND Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MPND Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 471 of Human FLJ14981 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MPND
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
77.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MPND Protein

  • EC 3.4
  • FLJ14981
  • MPN domain containing
  • MPN domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2330
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-79745
Species: Hu
Applications: WB
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP2-30061
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MPND Recombinant Protein (H00084954-P01) (0)

There are no publications for MPND Recombinant Protein (H00084954-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPND Recombinant Protein (H00084954-P01) (0)

There are no reviews for MPND Recombinant Protein (H00084954-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPND Recombinant Protein (H00084954-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPND Products

Bioinformatics Tool for MPND Recombinant Protein (H00084954-P01)

Discover related pathways, diseases and genes to MPND Recombinant Protein (H00084954-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPND Recombinant Protein (H00084954-P01)

Discover more about diseases related to MPND Recombinant Protein (H00084954-P01).

Blogs on MPND

There are no specific blogs for MPND, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MPND Antibody
NBP2-30571

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MPND Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MPND