We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MPHOSPH1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MPHOSPH1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-88042PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MPHOSPH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF20B.

Source: E. coli

Amino Acid Sequence: KVETEEATACLELKFNQIKAELAKTKGELIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQQDEPPAKKGSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF20B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88042.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MPHOSPH1 Recombinant Protein Antigen

  • Cancer/testis antigen 90
  • CT90MPP-1
  • DKFZp434B0435
  • EC 6.3.5.5
  • kinesin family member 20B
  • Kinesin-related motor interacting with PIN1
  • KRMP1kinesin-like protein KIF20B
  • M-phase phosphoprotein 1mitotic kinesin-like protein
  • MPHOSPH1EC 2.1.1
  • MPP1DKFZp434P0810

Background

MPHOSPH1, also known as Kinesin-like protein KIF20B, has 4 isoforms, a 1,820 amino acid isoform that is 211 kDa, a 1,853 amino acid isoform that is 214 kDa, a 1,780 amino acid isoform that is 200 kDa, and a 512 amino acid isoform that is 60 kDa, localizes mainly in the nucleus during interphase although it is also detected in the cytoplasm without clear association with microtubules, it is found in brain, ovary, kidney and testis, and acts as a plus-end-directed motor enzyme that is required for completion of cytokinesis. Disease research is currently being studied with relation to MPHOSPH1 and myeloproliferative disorder, intrahepatic cholangiocarcinoma, cholangiocarcinoma, Alzheimer's disease, and ataxia. This protein involvement has been observed with trelation to MYC, PIN1, RUVBL1, YWHAB, and CDK1proteins in M phase of mitotic cell cycle, ATP catabolic process, microtubule-based movement, cell cycle arrest, and mitosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
DRT100
Species: Hu
Applications: ELISA
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DR2A00
Species: Hu
Applications: ELISA
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-56923
Species: Hu
Applications: ICC/IF
MAB9080
Species: Hu
Applications: WB
AF3975
Species: Hu
Applications: ICC, WB
NBP1-85038
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85014
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
DY1335B
Species: Hu
Applications: ELISA
NBP1-88042PEP
Species: Hu
Applications: AC

Publications for MPHOSPH1 Protein (NBP1-88042PEP) (0)

There are no publications for MPHOSPH1 Protein (NBP1-88042PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPHOSPH1 Protein (NBP1-88042PEP) (0)

There are no reviews for MPHOSPH1 Protein (NBP1-88042PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MPHOSPH1 Protein (NBP1-88042PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPHOSPH1 Products

Research Areas for MPHOSPH1 Protein (NBP1-88042PEP)

Find related products by research area.

Blogs on MPHOSPH1

There are no specific blogs for MPHOSPH1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MPHOSPH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF20B