MMP20 Antibody

Product Discontinued

MMP20 Antibody Summary

• Immunogen: Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected form the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA.
• Predicted Species: Mouse (100%), Rat (92%), Porcine (100%), Bovine (93%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP20
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This is a rabbit polyclonal antibody against MMP20 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MMP20 Antibody

• AI2A2
• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.22
• EC 3.4.24.35
• Enamel metalloproteinase
• Enamelysin
• matrix metallopeptidase 20
• matrix metalloproteinase 20 (enamelysin)
• matrix metalloproteinase-20
• MMP20
• MMP-20

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in this gene, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. This gene is part of a cluster of MMP genes that localizes to chromosome 11q22.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP20
• OMIM:
  • NP_004762(Human)
• Uniprot:
  • O60882(Human)