MMGT1 Antibody

Images

 
Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human kidney shows strong membranous positivity in cells of tubules
Immunohistochemistry: MMGT1 Antibody [NBP1-90652] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMGT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMGT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MMGT1 Protein (NBP1-90652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMGT1 Antibody

  • membrane magnesium transporter 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-404
Species: Hu, Mu
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90652
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MMGT1 Antibody (NBP1-90652) (0)

There are no publications for MMGT1 Antibody (NBP1-90652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMGT1 Antibody (NBP1-90652) (0)

There are no reviews for MMGT1 Antibody (NBP1-90652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMGT1 Antibody (NBP1-90652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMGT1 Products

Bioinformatics Tool for MMGT1 Antibody (NBP1-90652)

Discover related pathways, diseases and genes to MMGT1 Antibody (NBP1-90652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMGT1 Antibody (NBP1-90652)

Discover more about diseases related to MMGT1 Antibody (NBP1-90652).
 

Pathways for MMGT1 Antibody (NBP1-90652)

View related products by pathway.

PTMs for MMGT1 Antibody (NBP1-90652)

Learn more about PTMs related to MMGT1 Antibody (NBP1-90652).

Blogs on MMGT1

There are no specific blogs for MMGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMGT1