![Western Blot: MMGT1 Antibody [NBP1-90652] - Analysis in control (vector only transfected HEK293T lysate) and MMGT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/MMGT1-Antibody-Western-Blot-NBP1-90652-img0005.jpg "Western Blot: MMGT1 Antibody [NBP1-90652] - Analysis in control (vector only transfected HEK293T lysate) and MMGT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MMGT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB600-404-img0049.jpg)
-Immunohistochemistry-Paraffin-NB600-404-img0050.jpg)
-Immunohistochemistry-NB600-404-img0052.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0005.jpg)
-Immunohistochemistry-NBP1-78159-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0007.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-42225-img0008.jpg)
-Flow-(Intracellular)-NBP2-42225-img0009.jpg)
-Western-Blot-NBP2-42225-img0007.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for MMGT1 Antibody (NBP1-90652)Discover more about diseases related to MMGT1 Antibody (NBP1-90652).
| Pathways for MMGT1 Antibody (NBP1-90652)View related products by pathway.
|
PTMs for MMGT1 Antibody (NBP1-90652)Learn more about PTMs related to MMGT1 Antibody (NBP1-90652).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MMGT1 |
![Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human duodenum shows weak granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/MMGT1-Antibody-Immunohistochemistry-Paraffin-NBP1-90652-img0008.jpg "Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human duodenum shows weak granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human kidney shows strong membranous positivity in cells of tubules](http://images.novusbio.com/fullsize2/MMGT1-Antibody-Immunohistochemistry-Paraffin-NBP1-90652-img0002.jpg "Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human kidney shows strong membranous positivity in cells of tubules")
![Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize2/MMGT1-Antibody-Immunohistochemistry-Paraffin-NBP1-90652-img0006.jpg "Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/MMGT1-Antibody-Immunohistochemistry-Paraffin-NBP1-90652-img0007.jpg "Immunohistochemistry-Paraffin: MMGT1 Antibody [NBP1-90652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.")
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_CF_305.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_CF_307.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_555.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_556.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_20.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")