MMACHC Antibody

Images

 
Western Blot: MMACHC Antibody [NBP2-48582] - Analysis in control (vector only transfected HEK293T lysate) and MMACHC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: MMACHC Antibody [NBP2-48582] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMACHC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPT
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMACHC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MMACHC Recombinant Protein Antigen (NBP2-48582PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMACHC Antibody

  • cblC
  • DKFZP564I122
  • FLJ25671
  • methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria
  • methylmalonic aciduria and homocystinuria type C protein
  • RP11-291L19.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-791
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-86599
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03496
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38351
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-57749
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1936
Species: Hu
Applications: IP, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF8060
Species: Hu
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-48582
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MMACHC Antibody (NBP2-48582) (0)

There are no publications for MMACHC Antibody (NBP2-48582).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMACHC Antibody (NBP2-48582) (0)

There are no reviews for MMACHC Antibody (NBP2-48582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMACHC Antibody (NBP2-48582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMACHC Products

Bioinformatics Tool for MMACHC Antibody (NBP2-48582)

Discover related pathways, diseases and genes to MMACHC Antibody (NBP2-48582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMACHC Antibody (NBP2-48582)

Discover more about diseases related to MMACHC Antibody (NBP2-48582).
 

Pathways for MMACHC Antibody (NBP2-48582)

View related products by pathway.

PTMs for MMACHC Antibody (NBP2-48582)

Learn more about PTMs related to MMACHC Antibody (NBP2-48582).

Blogs on MMACHC

There are no specific blogs for MMACHC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMACHC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMACHC