Recombinant Human MKRN3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MKRN3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 437-507 of Human MKRN3

Source: Wheat Germ

Amino Acid Sequence: SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MKRN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MKRN3 Protein

  • EC 6.3.2.-
  • makorin ring finger protein 3
  • MGC88288
  • RNF63D15S9
  • ZFP127RING finger protein 63
  • Zinc finger protein 127
  • ZNF127probable E3 ubiquitin-protein ligase makorin-3

Background

MKRN3 - makorin, ring finger protein, 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
H00004948-Q01
Species: Hu
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-65126
Species: Hu
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
H00027130-P02
Species: Hu

Publications for MKRN3 Partial Recombinant Protein (H00007681-Q01) (0)

There are no publications for MKRN3 Partial Recombinant Protein (H00007681-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN3 Partial Recombinant Protein (H00007681-Q01) (0)

There are no reviews for MKRN3 Partial Recombinant Protein (H00007681-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKRN3 Partial Recombinant Protein (H00007681-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKRN3 Products

Bioinformatics Tool for MKRN3 Partial Recombinant Protein (H00007681-Q01)

Discover related pathways, diseases and genes to MKRN3 Partial Recombinant Protein (H00007681-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN3 Partial Recombinant Protein (H00007681-Q01)

Discover more about diseases related to MKRN3 Partial Recombinant Protein (H00007681-Q01).
 

Pathways for MKRN3 Partial Recombinant Protein (H00007681-Q01)

View related products by pathway.

PTMs for MKRN3 Partial Recombinant Protein (H00007681-Q01)

Learn more about PTMs related to MKRN3 Partial Recombinant Protein (H00007681-Q01).
 

Research Areas for MKRN3 Partial Recombinant Protein (H00007681-Q01)

Find related products by research area.

Blogs on MKRN3

There are no specific blogs for MKRN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MKRN3 Antibody
NBP1-84320

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MKRN3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN3