MKP-1/DUSP1 Antibody (4H7)


Sandwich ELISA: MKP-1/DUSP1 Antibody (4H7) [H00001843-M02] - Detection limit for recombinant GST tagged DUSP1 is 0.3 ng/ml as a capture antibody.
Proximity Ligation Assay: MKP-1/DUSP1 Antibody (4H7) [H00001843-M02] - Analysis of protein-protein interactions between MAPK3 and DUSP1. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, PLA

Order Details

MKP-1/DUSP1 Antibody (4H7) Summary

DUSP1 (NP_004408 305 a.a. - 367 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
DUSP1 - dual specificity phosphatase 1 (4H7)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Flow Cytometry
  • Proximity Ligation Assay
Application Notes
Antibody reactivity Against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. FACS usage was reported in scientific literature.
Read Publication using
H00001843-M02 in the following applications:

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKP-1/DUSP1 Antibody (4H7)

  • CL100
  • CL100MAP kinase phosphatase 1
  • dual specificity phosphatase 1
  • Dual specificity protein phosphatase hVH1
  • DUSP1
  • EC
  • EC
  • HVH1
  • Mitogen-activated protein kinase phosphatase 1
  • MKP1
  • MKP-1
  • MKP-1dual specificity protein phosphatase 1
  • Protein-tyrosine phosphatase CL100
  • PTPN10
  • PTPN10serine/threonine specific protein phosphatase
  • VH1


The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO

Publications for MKP-1/DUSP1 Antibody (H00001843-M02)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: FLOW.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MKP-1/DUSP1 Antibody (H00001843-M02) (0)

There are no reviews for MKP-1/DUSP1 Antibody (H00001843-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKP-1/DUSP1 Antibody (H00001843-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MKP-1/DUSP1 Products

Bioinformatics Tool for MKP-1/DUSP1 Antibody (H00001843-M02)

Discover related pathways, diseases and genes to MKP-1/DUSP1 Antibody (H00001843-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKP-1/DUSP1 Antibody (H00001843-M02)

Discover more about diseases related to MKP-1/DUSP1 Antibody (H00001843-M02).

Pathways for MKP-1/DUSP1 Antibody (H00001843-M02)

View related products by pathway.

PTMs for MKP-1/DUSP1 Antibody (H00001843-M02)

Learn more about PTMs related to MKP-1/DUSP1 Antibody (H00001843-M02).

Research Areas for MKP-1/DUSP1 Antibody (H00001843-M02)

Find related products by research area.

Blogs on MKP-1/DUSP1

There are no specific blogs for MKP-1/DUSP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MKP-1/DUSP1 Antibody (4H7) and receive a gift card or discount.


Gene Symbol DUSP1