MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Analysis of monoclonal antibody to DUSP1 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Detection limit for recombinant GST tagged DUSP1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
• Specificity: DUSP1 - dual specificity phosphatase 1 (3A9)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DUSP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

• CL100
• CL100MAP kinase phosphatase 1
• dual specificity phosphatase 1
• Dual specificity protein phosphatase hVH1
• DUSP1
• EC 3.1.3.16
• EC 3.1.3.48
• HVH1
• Mitogen-activated protein kinase phosphatase 1
• MKP1
• MKP-1
• MKP-1dual specificity protein phosphatase 1
• Protein-tyrosine phosphatase CL100
• PTPN10
• PTPN10serine/threonine specific protein phosphatase
• VH1

Background

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MKP-1/DUSP1 Antibody (H00001843-M05)(1)

Publication using H00001843-M05

• Chao YN, Sun D, Peng YC, Wu YL. Growth Hormone Releasing Peptide-2 Attenuation of Protein Kinase C-Induced Inflammation in Human Ovarian Granulosa Cells. Int J Mol Sci 2016-08-19 [PMID: 27548147]

Bioinformatics

• Gene Symbol: DUSP1
• Entrez:
  • 1843(Human)
• Uniprot:
  • NP_004408(Human)