Mitocondrial Translational Initiation Factor 3 Antibody [mFluor Violet 450 SE] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-278 of human Mitocondrial Translational Initiation Factor 3 (NP_690876.3).
Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MTIF3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for Mitocondrial Translational Initiation Factor 3 Antibody [mFluor Violet 450 SE]
Background
The Mitocondrial Translational Initiation Factor 3 gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism inthis gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcriptvariants. A pseudogene of
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Mitocondrial Translational Initiation Factor 3 Antibody (NBP3-35257MFV450) (0)
There are no publications for Mitocondrial Translational Initiation Factor 3 Antibody (NBP3-35257MFV450).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mitocondrial Translational Initiation Factor 3 Antibody (NBP3-35257MFV450) (0)
There are no reviews for Mitocondrial Translational Initiation Factor 3 Antibody (NBP3-35257MFV450).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mitocondrial Translational Initiation Factor 3 Antibody (NBP3-35257MFV450) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mitocondrial Translational Initiation Factor 3 Products
Blogs on Mitocondrial Translational Initiation Factor 3