mitochondrial ribosomal protein L4 Antibody - BSA Free

Western Blot: mitochondrial ribosomal protein L4 Antibody [NBP2-85292] - Host: Rabbit. Target Name: MRPL4. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

mitochondrial ribosomal protein L4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human mitochondrial ribosomal protein L4. Peptide sequence: YAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for mitochondrial ribosomal protein L4 Antibody - BSA Free

• CGI-28
• L4mt
• MGC16367
• MGC2681
• mitochondrial ribosomal protein L4,39S ribosomal protein L4, mitochondrial
• MRP-L4

Background

MRPL4, also known as 39 S ribosomal protein L4, mitochondrial, consists of a 34.9 kDa and a 29.5 kDa isoform and is involved in mitochondrial protein synthesis as a component of the 39S ribosomal subunit. Diseases and disorders such as mycobacterium tuberculosis and pneumonia are being researched with the protein. In translation pathways, the protein interacts with DDX24, EIF2B1, ICT1, KRTAP4-12, and TIMM44.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL4