mitochondrial ribosomal protein L4 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human mitochondrial ribosomal protein L4. Peptide sequence: YAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for mitochondrial ribosomal protein L4 Antibody - BSA Free
Background
MRPL4, also known as 39 S ribosomal protein L4, mitochondrial, consists of a 34.9 kDa and a 29.5 kDa isoform and is involved in mitochondrial protein synthesis as a component of the 39S ribosomal subunit. Diseases and disorders such as mycobacterium tuberculosis and pneumonia are being researched with the protein. In translation pathways, the protein interacts with DDX24, EIF2B1, ICT1, KRTAP4-12, and TIMM44.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA
Species: Ha, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for mitochondrial ribosomal protein L4 Antibody (NBP2-85292) (0)
There are no publications for mitochondrial ribosomal protein L4 Antibody (NBP2-85292).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for mitochondrial ribosomal protein L4 Antibody (NBP2-85292) (0)
There are no reviews for mitochondrial ribosomal protein L4 Antibody (NBP2-85292).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for mitochondrial ribosomal protein L4 Antibody (NBP2-85292) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional mitochondrial ribosomal protein L4 Products
Research Areas for mitochondrial ribosomal protein L4 Antibody (NBP2-85292)
Find related products by research area.
|
Blogs on mitochondrial ribosomal protein L4