MIS18A Recombinant Protein Antigen

Images

 
There are currently no images for MIS18A Protein (NBP1-88944PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MIS18A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIS18A.

Source: E.coli

Amino Acid Sequence: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVF

Protein/Peptide Type
Recombinant Protein Antigen
Gene
MIS18A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88944.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MIS18A Recombinant Protein Antigen

  • B28
  • C21orf45
  • C21orf46
  • FAPP1-associated protein 1
  • FASP1
  • hMis18alpha
  • MIS18 kinetochore protein homolog A (S. pombe)
  • MIS18alpha
  • protein Mis18-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13608
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28140
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
MAB5756
Species: Hu
Applications: Flow
NBP1-89905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00768
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NBP2-13688
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for MIS18A Protein (NBP1-88944PEP) (0)

There are no publications for MIS18A Protein (NBP1-88944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIS18A Protein (NBP1-88944PEP) (0)

There are no reviews for MIS18A Protein (NBP1-88944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MIS18A Protein (NBP1-88944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MIS18A Products

MIS18A NBP1-88944PEP

Bioinformatics Tool for MIS18A Protein (NBP1-88944PEP)

Discover related pathways, diseases and genes to MIS18A Protein (NBP1-88944PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MIS18A Protein (NBP1-88944PEP)

View related products by pathway.

PTMs for MIS18A Protein (NBP1-88944PEP)

Learn more about PTMs related to MIS18A Protein (NBP1-88944PEP).

Blogs on MIS18A

There are no specific blogs for MIS18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MIS18A Antibody
NBP1-88943
MIS18A Antibody
NBP1-88943
MIS18A Antibody
NBP1-88943

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MIS18A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MIS18A