MIPOL1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MIPOL1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MIPOL1.
  
  

  Source: E. coli

  Amino Acid Sequence: KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MIPOL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86161.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MIPOL1 Recombinant Protein Antigen

• DKFZp313M2036
• MGC34010
• mirror-image polydactyly 1
• mirror-image polydactyly gene 1 protein

Background

MIPOL1, also known as Mirror-image polydactyly gene 1 protein, has 3 isoforms, a 442 amino acid isoform1 that is 51 kDa, a 261 amino acid isoform 2 that is 30 kDa and a short 169 amino acid isoform 3 that is 20 kDa; expressed very weakly in heart, liver, skeletal muscle, kidney, pancreas and fetal kidney; and may function as a tumor suppressor. Studies on this protein have shown a relationship with the following diseases and disorders: mirror-image polydactyly, Laurin-Sandrow syndrome, adult astrocytic tumour, fibular hypoplasia, intrahepatic cholangiocarcinoma, nasopharyngitis and carcinoma. This protein has shown an interaction with UBC protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MIPOL1