Recombinant Human NRK1 His Protein Summary
| Description |
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-199 of Human NRK1
Source: E.coli
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMGS>MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
NMRK1 |
| Purity |
>90%, by SDS-PAGE |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
25.6 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
Phosphate-Buffered Saline (pH 7.4), 10% Glycerol |
| Preservative |
No Preservative |
| Concentration |
0.5 mg/ml |
| Purity |
>90%, by SDS-PAGE |
Alternate Names for Recombinant Human NRK1 His Protein
Background
Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: AdBlk, CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for NRK1 Recombinant Protein (NBP1-98958) (0)
There are no publications for NRK1 Recombinant Protein (NBP1-98958).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NRK1 Recombinant Protein (NBP1-98958) (0)
There are no reviews for NRK1 Recombinant Protein (NBP1-98958).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NRK1 Recombinant Protein (NBP1-98958) (0)
Additional NRK1 Products
Research Areas for NRK1 Recombinant Protein (NBP1-98958)
Find related products by research area.
|
Blogs on NRK1