We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MGMT Recombinant Protein Antigen

Images

 
There are currently no images for MGMT Recombinant Protein Antigen (NBP2-58611PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MGMT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGMT.

Source: E. coli

Amino Acid Sequence: PILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGMT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58611.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MGMT Recombinant Protein Antigen

  • 6-O-methylguanine-DNA methyltransferase
  • EC 2.1.1.63
  • methylated-DNA--protein-cysteine methyltransferase
  • methylguanine-DNA methyltransferase
  • MGMT
  • O-6-methylguanine-DNA methyltransferase
  • O6-methylguanine-DNA methyltransferase
  • O-6-methylguanine-DNA-alkyltransferase

Background

O6-Methylguanine-DNA Methyltransferase (MGMT) is an important DNA repair protein involved in tumor cell resistance to the cytotoxic activity of chemotherapeutic alkylating agents. This protein is also effective in protecting normal cells against the genotoxic and carcinogenic effects of DNA alkylation. The alkylating drug resistance is caused by MGMT's ability to remove DNA alkyl groups introduced in the O6 position of guanine. MGMT is expressed in highly variable amounts, depending upon the cell and tissue type, species, and cellular growth characteristics. In addition, MGMT activity varies among groups of tumors and within a particular type of tumor.

MGMT antibodes are useful tools for DNA repair studies and for some cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP3-21649
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-82454
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
352-MS
Species: Hu
Applications: BA
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF4885
Species: Mu
Applications: IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB7049
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-87430
Species: Hu
Applications: IHC,  IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P

Publications for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no publications for MGMT Recombinant Protein Antigen (NBP2-58611PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no reviews for MGMT Recombinant Protein Antigen (NBP2-58611PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MGMT Recombinant Protein Antigen (NBP2-58611PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGMT Products

Research Areas for MGMT Recombinant Protein Antigen (NBP2-58611PEP)

Find related products by research area.

Blogs on MGMT

There are no specific blogs for MGMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MGMT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MGMT