METTL14 Antibody [CoraFluor™ 1]

Name: METTL14 Antibody [CoraFluor&#8482; 1]
Brand: Novus Biologicals
SKU: NBP3-38559CL1
Price: 1009 USD
Availability: InStock

Submit a Review

Images

There are currently no images for METTL14 Antibody (NBP3-38559CL1).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, ELISA, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	CoraFluor 1

Order Details

View Available Conjugates

Catalog# & Conjugate	Size	Price
Alexa Fluor 350 NBP3-38559AF350

Alexa Fluor 405 NBP3-38559AF405

Alexa Fluor 488 NBP3-38559AF488

Alexa Fluor 532 NBP3-38559AF532

Alexa Fluor 594 NBP3-38559AF594

Alexa Fluor 647 NBP3-38559AF647

Alexa Fluor 700 NBP3-38559AF700

Alexa Fluor 750 NBP3-38559AF750

Allophycocyanin NBP3-38559APC

Biotin NBP3-38559B

DyLight 350 NBP3-38559UV

DyLight 405 NBP3-38559V

DyLight 488 NBP3-38559G

DyLight 550 NBP3-38559R

DyLight 594 NBP3-38559DL594

DyLight 650 NBP3-38559C

DyLight 680 NBP3-38559FR

DyLight 755 NBP3-38559IR

FITC NBP3-38559F

HRP NBP3-38559H

Janelia Fluor 525 NBP3-38559JF525

Janelia Fluor 549 NBP3-38559JF549

Janelia Fluor 646 NBP3-38559JF646

Janelia Fluor 669 NBP3-38559JF669

PE NBP3-38559PE

PerCP NBP3-38559PCP

Unconjugated NBP3-38559-100ul

mFluor Violet 450 SE NBP3-38559MFV450

mFluor Violet 500 SE NBP3-38559MFV500

mFluor Violet 610 SE NBP3-38559MFV610

View Available Formulations

Catalog# & Formulation	Size	Price
Standard Formulation NBP3-38559-100ul

BSA Free NBP3-38559-100ul

BSA Free NBP3-38559-20ul

Novus Biologicals offers 100% Guarantee

Conjugate	Catalog #	Availability	Size	Price
Alexa Fluor 350	NBP3-38559AF350
Alexa Fluor 405	NBP3-38559AF405
Alexa Fluor 488	NBP3-38559AF488
Alexa Fluor 532	NBP3-38559AF532
Alexa Fluor 594	NBP3-38559AF594
Alexa Fluor 647	NBP3-38559AF647
Alexa Fluor 700	NBP3-38559AF700
Alexa Fluor 750	NBP3-38559AF750
Allophycocyanin	NBP3-38559APC
Biotin	NBP3-38559B
DyLight 350	NBP3-38559UV
DyLight 405	NBP3-38559V
DyLight 488	NBP3-38559G
DyLight 550	NBP3-38559R
DyLight 594	NBP3-38559DL594
DyLight 650	NBP3-38559C
DyLight 680	NBP3-38559FR
DyLight 755	NBP3-38559IR
FITC	NBP3-38559F
HRP	NBP3-38559H
Janelia Fluor 525	NBP3-38559JF525
Janelia Fluor 549	NBP3-38559JF549
Janelia Fluor 646	NBP3-38559JF646
Janelia Fluor 669	NBP3-38559JF669
PE	NBP3-38559PE
PerCP	NBP3-38559PCP
Unconjugated	NBP3-38559-100ul
mFluor Violet 450 SE	NBP3-38559MFV450
mFluor Violet 500 SE	NBP3-38559MFV500
mFluor Violet 610 SE	NBP3-38559MFV610

METTL14 Antibody [CoraFluor™ 1] Summary

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1). Sequence: MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	METTL14
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Immunohistochemistry Immunohistochemistry-Paraffin Western Blot
Application Notes	Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage	Store at 4C in the dark. Do not freeze.
Buffer	PBS
Preservative	No Preservative
Purity	Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for METTL14 Antibody [CoraFluor™ 1]

EC 2.1.1
EC 2.1.1.-
KIAA1627
KIAA1627methyltransferase-like protein 14
methyltransferase like 14
METTL14

Background

Probable methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PYCR2 Antibody -
Azide and BSA Free

NBP2-93882

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TDP-43/TARDBP
Antibody (2E2-D3) - A ...

H00023435-M01

(3 Reviews)

(212 Publications)

Species: Ba, Pp, Hu, I, Pm, Mu, Rt

Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB

TRAIL/TNFSF10
[Unconjugated]

375-TL

(1 Review)

(54 Publications)

Species: Hu

Applications: BA

PSTPIP1 Antibody -
BSA Free

NBP1-85764

Immunohistochemistry-Paraffin PSTPIP1 Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

PDCD5 Antibody
(728906)

MAB7325

Immunohistochemistry PDCD5 Antibody (728906)

(1 Review)

Species: Hu, Mu, Rt

Applications: IHC, WB

PCK2 Antibody -
BSA Free

NBP2-33606

Immunohistochemistry-Paraffin PCK2 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

UBE2E3 Antibody
(OTI7E8)

NBP2-03819

Immunohistochemistry-Paraffin UBE2E3 Antibody (OTI7E8)

(1 Review)

(1 Publication)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Glut2 Antibody -
BSA Free

NBP2-22218

Immunohistochemistry-Paraffin Glut2 Antibody - BSA Free

(2 Reviews)

(15 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

KLF5 Antibody
[Unconjugated]

AF3758

Knockout Validated KLF5 Antibody [Unconjugated]

Immunocytochemistry KLF5 Antibody [Unconjugated]

(17 Publications)

Species: Hu, Mu

Applications: ICC, KO, Simple Western, WB

Lipin 1 Antibody -
BSA Free

NB110-57150

Immunohistochemistry Lipin 1 Antibody - BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

TAK1 Antibody

NB100-56363

Immunocytochemistry/ Immunofluorescence TAK1 Antibody

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

METTL14 Antibody
[CoraFluor™ 1]

NBP3-38559CL1

Species: Hu, Mu, Rt

Applications: WB, ELISA, IHC

Publications for METTL14 Antibody (NBP3-38559CL1) (0)

There are no publications for METTL14 Antibody (NBP3-38559CL1).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL14 Antibody (NBP3-38559CL1) (0)

There are no reviews for METTL14 Antibody (NBP3-38559CL1). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METTL14 Antibody (NBP3-38559CL1) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional METTL14 Products

Research Areas for METTL14 Antibody (NBP3-38559CL1)

Find related products by research area.

Lipid and Metabolism

Blogs on METTL14

There are no specific blogs for METTL14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRAIL/TNFSF10 [Unconjugated]
375-TL-010

Western Blot: TDP-43/TARDBP Antibody (2E2-D3) [H00023435-M01] - PDI co-precipitates with TDP-43/TARDBP and is increased in mutant TDP-43 transgenic mouse spinal cords. Co-immunoprecipitation of wildtype and mutant Q331K TDP-43-mCherry from Neuro2a cell lysates using an anti-PDI antibody followed by TDP-43 immunoblot. Control immunoprecipitations were performed using untransfected (Untrans) or mCherry expressing cell lysates, buffer only with coprecipitating antibodies or TDP-43 Q331K cell lysates using an irrelevant, isotype-matched control antibody (IgG). Input control (2%) shows expression of mCherry-TDP43 in wildtype and Q331K cell lysates. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0081170) licensed under a CC-BY license.

TDP-43/TARDBP Antibody (2E2-D3) - Azide and BSA Free
H00023435-M01

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our METTL14 Antibody [CoraFluor™ 1] and receive a gift card or discount.

Bioinformatics

Gene Symbol

METTL14

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

METTL14 Antibody [CoraFluor™ 1]

Species Glossary

Images

Product Details

Order Details

METTL14 Antibody [CoraFluor™ 1] Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for METTL14 Antibody [CoraFluor™ 1]

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for METTL14 Antibody (NBP3-38559CL1) (0)

Reviews for METTL14 Antibody (NBP3-38559CL1) (0)

Product General Protocols

Video Protocols

FAQs for METTL14 Antibody (NBP3-38559CL1) (0)

Secondary Antibodies

Isotype Controls

Additional METTL14 Products

Research Areas for METTL14 Antibody (NBP3-38559CL1)

Blogs on METTL14

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics