Metallothionein-1E Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Metallothionein-1E Antibody [NBP1-87740] - Staining of human cell line BJ shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Metallothionein-1E Antibody [NBP1-87740] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Metallothionein-1E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSCKKSECGAISRNLGLWLRLGGNSRLALSASFWGTGLSLPSLPVSFPLQAFCPKFRWGRTAFFSWDTNPNCTPYGFRTELCQTKKSILWVWV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MT1E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
Metallothionein-1E Protein (NBP1-87740PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Metallothionein-1E Antibody

  • metallothionein 1E (functional)
  • metallothionein 1E
  • metallothionein D
  • metallothionein-1E
  • metallothionein-IE
  • MT1
  • MT-1E
  • MTD
  • MT-IE

Background

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NLS932
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-67415
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DTM100
Species: Hu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
NBP1-97493
Species: Eq, Fi, Hu, Mu, Rb, Rt
Applications: EIA, IHC, IHC-P, WB
NBL1-13348
Species: Hu
Applications: WB
H00004494-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB

Publications for Metallothionein-1E Antibody (NBP1-87740) (0)

There are no publications for Metallothionein-1E Antibody (NBP1-87740).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Metallothionein-1E Antibody (NBP1-87740) (0)

There are no reviews for Metallothionein-1E Antibody (NBP1-87740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Metallothionein-1E Antibody (NBP1-87740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Metallothionein-1E Products

Bioinformatics Tool for Metallothionein-1E Antibody (NBP1-87740)

Discover related pathways, diseases and genes to Metallothionein-1E Antibody (NBP1-87740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Metallothionein-1E Antibody (NBP1-87740)

Discover more about diseases related to Metallothionein-1E Antibody (NBP1-87740).
 

Pathways for Metallothionein-1E Antibody (NBP1-87740)

View related products by pathway.

PTMs for Metallothionein-1E Antibody (NBP1-87740)

Learn more about PTMs related to Metallothionein-1E Antibody (NBP1-87740).

Blogs on Metallothionein-1E

There are no specific blogs for Metallothionein-1E, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Metallothionein-1E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MT1E