Novus Biologicals products are now on bio-techne.com

Melanoma antigen family C2 Recombinant Protein Antigen

Images

 
There are currently no images for Melanoma antigen family C2 Protein (NBP2-34145PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Melanoma antigen family C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAGEC2.

Source: E. coli

Amino Acid Sequence: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAGEC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34145.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Melanoma antigen family C2 Recombinant Protein Antigen

  • Cancer/testis antigen 10
  • CT10MAGE-E1 antigen
  • HCA587MAGE-C2
  • hepatocellular cancer antigen 587
  • Hepatocellular carcinoma-associated antigen 587
  • MAGE-C2 antigen
  • MAGEE1MGC13377
  • melanoma antigen family C, 2
  • melanoma antigen, family E, 1, cancer/testis specific
  • melanoma-associated antigen C2

Background

Melanoma antigen family C2 is related to members of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85397
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-84354
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32871
Species: Ca, Hu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
AF5414
Species: Hu
Applications: Simple Western, WB

Publications for Melanoma antigen family C2 Protein (NBP2-34145PEP) (0)

There are no publications for Melanoma antigen family C2 Protein (NBP2-34145PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanoma antigen family C2 Protein (NBP2-34145PEP) (0)

There are no reviews for Melanoma antigen family C2 Protein (NBP2-34145PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Melanoma antigen family C2 Protein (NBP2-34145PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Melanoma antigen family C2 Products

Blogs on Melanoma antigen family C2

There are no specific blogs for Melanoma antigen family C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Melanoma antigen family C2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC2