Recombinant Human MED26 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MED26 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 501-600 of Human CRSP7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MED26
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED26 Protein

  • Activator-recruited cofactor 70 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 7
  • cofactor required for Sp1 transcriptional activation, subunit 7 (70kD)
  • cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa
  • CRSP70ARC70
  • CRSP7CRSP complex subunit 7
  • mediator complex subunit 26Transcriptional coactivator CRSP70
  • mediator of RNA polymerase II transcription subunit 26

Background

CRSP7 - cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-90034
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56318
Species: Hu
Applications: ICC/IF
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009443-M01
Species: Hu
Applications: WB, ELISA
NB100-757
Species: Hu
Applications: WB, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-84863
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
MAB6799
Species: Hu
Applications: WB, IHC
H00009441-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MED26 Partial Recombinant Protein (H00009441-Q01) (0)

There are no publications for MED26 Partial Recombinant Protein (H00009441-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED26 Partial Recombinant Protein (H00009441-Q01) (0)

There are no reviews for MED26 Partial Recombinant Protein (H00009441-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED26 Partial Recombinant Protein (H00009441-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED26 Products

Bioinformatics Tool for MED26 Partial Recombinant Protein (H00009441-Q01)

Discover related pathways, diseases and genes to MED26 Partial Recombinant Protein (H00009441-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED26 Partial Recombinant Protein (H00009441-Q01)

Discover more about diseases related to MED26 Partial Recombinant Protein (H00009441-Q01).
 

Pathways for MED26 Partial Recombinant Protein (H00009441-Q01)

View related products by pathway.

Blogs on MED26

There are no specific blogs for MED26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
MED26 Antibody (2G10)
H00009441-M06
CDC2L6 Antibody
NBP1-90034

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED26 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED26