Recombinant Human MED19 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MED19 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 194 of Human MED19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MED19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
46.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED19 Protein

  • LCMR1mediator of RNA polymerase II transcription subunit 19
  • Lung cancer metastasis-related protein 1
  • mediator complex subunit 19DT2P1G7
  • mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 19 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP2-62629
Species: Hu
Applications: IHC, IHC-P
NBP2-64704
Species: Hu
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009443-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00006334-Q01
Species: Hu
NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055588-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001297-P01
Species: Hu
NBP2-56318
Species: Hu
Applications: ICC/IF
NB100-495
Species: Hu
Applications: WB, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for MED19 Recombinant Protein (H00219541-P01) (0)

There are no publications for MED19 Recombinant Protein (H00219541-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED19 Recombinant Protein (H00219541-P01) (0)

There are no reviews for MED19 Recombinant Protein (H00219541-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED19 Recombinant Protein (H00219541-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED19 Products

Bioinformatics Tool for MED19 Recombinant Protein (H00219541-P01)

Discover related pathways, diseases and genes to MED19 Recombinant Protein (H00219541-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED19 Recombinant Protein (H00219541-P01)

Discover more about diseases related to MED19 Recombinant Protein (H00219541-P01).
 

Pathways for MED19 Recombinant Protein (H00219541-P01)

View related products by pathway.

PTMs for MED19 Recombinant Protein (H00219541-P01)

Learn more about PTMs related to MED19 Recombinant Protein (H00219541-P01).

Blogs on MED19

There are no specific blogs for MED19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MED19 Antibody
NBP1-81320
MED15 Antibody
NBP1-89018

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED19