MED13 Recombinant Protein Antigen

Images

 
There are currently no images for MED13 Recombinant Protein Antigen (NBP2-57545PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED13.

Source: E. coli

Amino Acid Sequence: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57545.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED13 Recombinant Protein Antigen

  • Activator-recruited cofactor 250 kDa component
  • KIAA0593HSPC221
  • mediator complex subunit 13ARC250
  • mediator of RNA polymerase II transcription, subunit 13 homolog
  • THRAP1mediator of RNA polymerase II transcription subunit 13
  • thyroid hormone receptor associated protein 1
  • Thyroid hormone receptor-associated protein 1
  • Thyroid hormone receptor-associated protein complex 240 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP240
  • thyroid hormone receptor-associated protein, 240 kDa subunit
  • Trap240
  • TRAP240DRIP250
  • Vitamin D3 receptor-interacting protein complex component DRIP250

Background

MED13 encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. The product of this gene is proposed to form a sub-complex with MED12, cyclin C, and CDK8 that can negatively regulate transactivation by mediator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
H00001024-M03
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-92902
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
MAB72891
Species: Hu
Applications: WB
NBP1-86185
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
NBP2-61772
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-84177
Species: Hu
Applications: IHC,  IHC-P, WB
DCMP0
Species: Hu
Applications: ELISA
H00001299-D01P
Species: Hu
Applications: WB
NBP2-92796
Species: Rt
Applications: WB
NBP3-22351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-57545PEP
Species: Hu
Applications: AC

Publications for MED13 Recombinant Protein Antigen (NBP2-57545PEP) (0)

There are no publications for MED13 Recombinant Protein Antigen (NBP2-57545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED13 Recombinant Protein Antigen (NBP2-57545PEP) (0)

There are no reviews for MED13 Recombinant Protein Antigen (NBP2-57545PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED13 Recombinant Protein Antigen (NBP2-57545PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED13 Products

Array NBP2-57545PEP

Blogs on MED13

There are no specific blogs for MED13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED13