MDM2/HDM2 Antibody (1A7)

Images

 
Western Blot: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - Analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody (M01), clone 1A7.Lane 1: MDM2 transfected lysate(55.2 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - Analysis of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. Antibody concentration 1.5 ug/ml.
Western Blot: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - MDM2 expression in Raw 264.7.
Western Blot: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - Analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi ( Cat # H00004193-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Proximity Ligation Assay: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - Analysis of protein-protein interactions between TP53 and MDM2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 ...read more
ELISA: MDM2/HDM2 Antibody (1A7) [H00004193-M01] - Detection limit for recombinant GST tagged MDM2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, PLA, RNAi
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MDM2/HDM2 Antibody (1A7) Summary

Immunogen
MDM2 (NP_002383, 101 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Specificity
Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MDM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MDM2/HDM2 Antibody (1A7)

  • ACTFS
  • HDM2
  • HDMX
  • MDM2 oncogene, E3 ubiquitin protein ligase
  • MDM2

Background

This gene is a target gene of the transcription factor tumor protein p53. The encoded protein is a nuclear phosphoprotein that binds and inhibits transactivation by tumor protein p53, as part of an autoregulatory negative feedback loop. Overexpression of this gene can result in excessive inactivation of tumor protein p53, diminishing its tumor suppressor function. This protein has E3 ubiquitin ligase activity, which targets tumor protein p53 for proteasomal degradation. This protein also affects the cell cycle, apoptosis, and tumorigenesis through interactions with other proteins, including retinoblastoma 1 and ribosomal protein L5. More than 40 different alternatively spliced transcript variants have been isolated from both tumor and normal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00056996-R01
Species: Hu
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MDM2/HDM2 Antibody (H00004193-M01) (0)

There are no publications for MDM2/HDM2 Antibody (H00004193-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDM2/HDM2 Antibody (H00004193-M01) (0)

There are no reviews for MDM2/HDM2 Antibody (H00004193-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDM2/HDM2 Antibody (H00004193-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDM2/HDM2 Products

Bioinformatics Tool for MDM2/HDM2 Antibody (H00004193-M01)

Discover related pathways, diseases and genes to MDM2/HDM2 Antibody (H00004193-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDM2/HDM2 Antibody (H00004193-M01)

Discover more about diseases related to MDM2/HDM2 Antibody (H00004193-M01).
 

Pathways for MDM2/HDM2 Antibody (H00004193-M01)

View related products by pathway.

PTMs for MDM2/HDM2 Antibody (H00004193-M01)

Learn more about PTMs related to MDM2/HDM2 Antibody (H00004193-M01).
 

Research Areas for MDM2/HDM2 Antibody (H00004193-M01)

Find related products by research area.

Blogs on MDM2/HDM2

There are no specific blogs for MDM2/HDM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDM2/HDM2 Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol MDM2
Entrez
OMIM
Uniprot