MCM3AP Recombinant Protein Antigen

Images

 
There are currently no images for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MCM3AP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCM3AP.

Source: E. coli

Amino Acid Sequence: RDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MCM3AP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCM3AP Recombinant Protein Antigen

  • 80 kDa MCM3-associated protein
  • FLJ44336
  • GANPFLJ45306
  • human mRNA for MCM3 import factor10Protein GANP
  • KIAA0572MAP80germinal center-associated nuclear protein
  • Map80
  • MCM3 import protein
  • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein
  • MCM3 minichromosome maintenance deficient 3 associated protein
  • minichromosome maintenance complex component 3 associated protein
  • minichromosome maintenance deficient (S. cerevisiae) 3-associated protein
  • minichromosome maintenance deficient 3-associated protein

Background

The mini-chromosome maintenance (MCM) family of proteins, including MCM2, MCM3, MCM4 (Cdc21), MCM5 (Cdc46), MCM6 (Mis5) and MCM7 (Cdc47), are regulators of DNA replication that act to ensure replication occurs only once in the cell cycle. Expression of MCM proteins increases during cell growth, peaking at G1 to S phase. The MCM proteins each contain an ATP-binding motif, which is predicted to mediate ATP-dependent opening of double-stranded DNA. MCM proteins are regulated by E2F transcription factors, which induce MCM expression, and by protein kinases, which interact with MCM proteins to maintain the postreplicative state of the cell. MCM2/MCM4 complexes function as substrates for Cdc2/cyclin B in vitro. Cleavage of MCM3, which can be prevented by caspase inhibitors, results in the inactivation of the MCM complex (composed of at least MCM proteins 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15386
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00009896-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00200576-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP3-45606
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1894
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF3635
Species: Mu
Applications: IHC, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP3-45454
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-76978
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-81765
Species: Hu
Applications: IHC,  IHC-P
NBP2-58502PEP
Species: Hu
Applications: AC

Publications for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP) (0)

There are no publications for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP) (0)

There are no reviews for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCM3AP Recombinant Protein Antigen (NBP2-58502PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCM3AP Products

Array NBP2-58502PEP

Blogs on MCM3AP

There are no specific blogs for MCM3AP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MCM3AP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM3AP