MBOAT1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MBOAT1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:500-1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for MBOAT1 Antibody
Background
MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Publications for MBOAT1 Antibody (NBP2-14223) (0)
There are no publications for MBOAT1 Antibody (NBP2-14223).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MBOAT1 Antibody (NBP2-14223) (0)
There are no reviews for MBOAT1 Antibody (NBP2-14223).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MBOAT1 Antibody (NBP2-14223) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MBOAT1 Products
Blogs on MBOAT1