MBOAT1 Antibody

Product Discontinued

MBOAT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBOAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MBOAT1 Antibody

• dJ434O11.1
• EC 2.3.1.-
• EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase
• LPEAT1
• LPLAT 1
• LPSAT
• lysophosphatidylethanolamine acyltransferase 1
• Lysophosphatidylserine acyltransferase
• lysophospholipid acyltransferase 1
• Lyso-PS acyltransferase
• membrane bound O-acyltransferase domain containing 1
• Membrane-bound O-acyltransferase domain-containing protein 1
• MGC44669
• OACT1
• O-acyltransferase (membrane bound) domain containing 1
• O-acyltransferase domain-containing protein 1

Background

MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBOAT1