Recombinant Human Matriptase/ST14 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 298-400 of Human ST14 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
ST14 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Matriptase/ST14 Protein
Background
ST14 - suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: EnzAct
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01) (0)
There are no publications for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01) (0)
There are no reviews for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01) (0)
Additional Matriptase/ST14 Products
Research Areas for Matriptase/ST14 Partial Recombinant Protein (H00006768-Q01)
Find related products by research area.
|
Blogs on Matriptase/ST14