MATH2/NEUROD6 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: AGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKS |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NEUROD6 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for MATH2/NEUROD6 Antibody
Background
NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Rt
Applications: IHC
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Publications for MATH2/NEUROD6 Antibody (NBP2-62687) (0)
There are no publications for MATH2/NEUROD6 Antibody (NBP2-62687).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MATH2/NEUROD6 Antibody (NBP2-62687) (0)
There are no reviews for MATH2/NEUROD6 Antibody (NBP2-62687).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MATH2/NEUROD6 Antibody (NBP2-62687) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MATH2/NEUROD6 Products
Blogs on MATH2/NEUROD6