MARCH4 Antibody

Images

 
Immunohistochemistry-Paraffin: MARCH4 Antibody [NBP1-91639] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: MARCH4 Antibody [NBP1-91639] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARCH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
Specificity
Specificity of human MARCH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARCH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin: HIER pH 6 retrieval method is recommended.
Control Peptide
MARCH4 Recombinant Protein Antigen (NBP1-91639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MARCH4 Antibody

  • EC 6.3.2.-
  • KIAA1399E3 ubiquitin-protein ligase MARCH4
  • MARCH-IVMGC104908
  • membrane-associated ring finger (C3HC4) 4
  • Membrane-associated RING finger protein 4
  • Membrane-associated RING-CH protein IV
  • RNF174RING finger protein 174

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00092979-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
7268-CT
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49496
Species: Hu
Applications: IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
9090-B2
Species: Hu
NBP1-92179
Species: Hu
Applications: IHC, IHC-P
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56761
Species: Hu
Applications: WB
NBP1-91639
Species: Hu
Applications: IHC, IHC-P

Publications for MARCH4 Antibody (NBP1-91639) (0)

There are no publications for MARCH4 Antibody (NBP1-91639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH4 Antibody (NBP1-91639) (0)

There are no reviews for MARCH4 Antibody (NBP1-91639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MARCH4 Antibody (NBP1-91639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MARCH4 Antibody (NBP1-91639)

Discover related pathways, diseases and genes to MARCH4 Antibody (NBP1-91639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH4 Antibody (NBP1-91639)

Discover more about diseases related to MARCH4 Antibody (NBP1-91639).
 

Pathways for MARCH4 Antibody (NBP1-91639)

View related products by pathway.

Research Areas for MARCH4 Antibody (NBP1-91639)

Find related products by research area.

Blogs on MARCH4

There are no specific blogs for MARCH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARCH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH4
Entrez
Uniprot